PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02666.1.g00180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MIKC_MADS
Protein Properties Length: 478aa    MW: 53197.7 Da    PI: 10.3272
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02666.1.g00180.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF86.61.4e-27174224151
                                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                                   krien++nrqvtfskRr g+lKKA+EL vLCda+v v+ifsstgk++ey+s
  Zmw_sc02666.1.g00180.1.am.mk 174 KRIENSTNRQVTFSKRRGGLLKKANELAVLCDARVGVVIFSSTGKMFEYCS 224
                                   79***********************************************96 PP

2K-box67.83.7e-23236328192
                         K-box   1 yqkssgks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieel 80 
                                   yq++++++  e ++ ++   e++++k+e+++L+  +R++ G+dL+sL+l + + LeqqLe s++k+R++K+ell +q+++l
  Zmw_sc02666.1.g00180.1.am.mk 236 YQHTTNNHfEEINHDQQIFVEMTRMKEEVDKLEMGIRRYAGDDLSSLTLSDVKDLEQQLEFSVNKVRARKHELLSQQLDNL 316
                                   56666777777788899999************************************************************* PP

                         K-box  81 qkkekelqeenk 92 
                                   ++k +e+q++n 
  Zmw_sc02666.1.g00180.1.am.mk 317 RRKINENQQQNL 328
                                   *********995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.5E-41166225IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.282166226IPR002100Transcription factor, MADS-box
CDDcd002657.80E-42167243No hitNo description
SuperFamilySSF554551.44E-32167254IPR002100Transcription factor, MADS-box
PROSITE patternPS003500168222IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-28168188IPR002100Transcription factor, MADS-box
PfamPF003193.4E-25175222IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-28188203IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-28203224IPR002100Transcription factor, MADS-box
PfamPF014868.8E-20246327IPR002487Transcription factor, K-box
PROSITE profilePS5129712.498250343IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008360Biological Processregulation of cell shape
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0080155Biological Processregulation of double fertilization forming a zygote and endosperm
GO:2000029Biological Processregulation of proanthocyanidin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
MILEKIKALP NFIVGKSISC SLKQAGFCRP TPPPRPCENR VRQAVPIKPG KQATQPSHRD  60
SMRSLGFLPA SVTIGGKRPR LLLLVAPAEI GKAERPGGAT RVEGMKITSY PALCTPLPAL  120
LYMSLLLPLL PQPFKQAPHK AASSRKSGGR NQFVDLPAKR RSLAAMGRGK IEIKRIENST  180
NRQVTFSKRR GGLLKKANEL AVLCDARVGV VIFSSTGKMF EYCSPTCSLK ELIEQYQHTT  240
NNHFEEINHD QQIFVEMTRM KEEVDKLEMG IRRYAGDDLS SLTLSDVKDL EQQLEFSVNK  300
VRARKHELLS QQLDNLRRKI NENQQQNLAV GRGDMKLAAE MSPLAMLPPP AVAFGHDAAA  360
YYGGESSSSS TALQLMSAAP QLHHPGGGEG FRLQPTQPNL QDLHHGHHGL QLCTVIFRPS  420
HCMFPIHPPG GLGRFYLSPT RGPNNVLRHH LWQQQKLQCC QGHGWALFIY FFKLRLEP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S3e-17166250183Myocyte-specific enhancer factor 2B
1tqe_R3e-17166250183Myocyte-specific enhancer factor 2B
1tqe_Q3e-17166250183Myocyte-specific enhancer factor 2B
1tqe_P3e-17166250183Myocyte-specific enhancer factor 2B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105130.11e-129MADS-box protein ZMM17
RefseqXP_002453370.11e-129hypothetical protein SORBIDRAFT_04g004736, partial
SwissprotQ8VWM81e-131M17_MAIZE; MADS-box protein ZMM17
TrEMBLB4FPJ31e-129B4FPJ3_MAIZE; Uncharacterized protein
TrEMBLC5XW431e-129C5XW43_SORBI; Putative uncharacterized protein Sb04g004736 (Fragment)
TrEMBLB6TVD91e-129B6TVD9_MAIZE; MADS-box transcription factor 29
STRINGSb04g004736.11e-128(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP185037100