PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02666.1.g00170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NF-YC
Protein Properties Length: 177aa    MW: 19450.1 Da    PI: 4.6476
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02666.1.g00170.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC61.91.3e-196611058102
                           NF-YC  58 ltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdelk 102
                                     ltlrsw+ +eenkrrt++k+diaaa+trtdi+dflvdi+prde+k
  Zmw_sc02666.1.g00170.1.sm.mkhc  66 LTLRSWMLTEENKRRTMQKNDIAAAITRTDIYDFLVDIIPRDEMK 110
                                     8*****************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471133.53E-965106IPR009072Histone-fold
Gene3DG3DSA:1.10.20.103.2E-1265106IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MLSSTGAKRM IHDAEVEAIL PVKIADFGQR RSDMESSPQP QPVMGVTTGT QGYPAATAAY  60
PPPAMLTLRS WMLTEENKRR TMQKNDIAAA ITRTDIYDFL VDIIPRDEMK VEGLGLPRVG  120
LPPAMGAPAD SYPPYYYVPA SQVPGAGMTY GAQQGRPMTY VWPQQPQGQE EEPPEDH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5g49_B2e-19661065595NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17884RRTMQKN
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of flowering time under long day (LD) conditions. Functions as repressor of flowering, independently of HD1 and GHD7. Controls flowering time by negatively regulating the expression of EHD1 and HD3A (PubMed:26542958). Component of the NF-Y/HAP transcription factor complex (By similarity). {ECO:0000250, ECO:0000269|PubMed:26542958}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation under long day (LD) conditions. Expression increases in the middle of daytime, peaks around the end of the light period and gradually decreases during the dark period and beginning of daylight. {ECO:0000269|PubMed:26542958}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020188795.14e-58nuclear transcription factor Y subunit C-4-like
SwissprotQ655V55e-50NFYC4_ORYSJ; Nuclear transcription factor Y subunit C-4
TrEMBLA0A0A9DBY31e-62A0A0A9DBY3_ARUDO; Uncharacterized protein
STRINGEMT165142e-57(Aegilops tauschii)
STRINGTraes_6BS_2951D8114.22e-57(Triticum aestivum)
STRINGTraes_6DS_8436285E5.12e-57(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP4533533
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Kim SK, et al.
    OsNF-YC2 and OsNF-YC4 proteins inhibit flowering under long-day conditions in rice.
    Planta, 2016. 243(3): p. 563-76
    [PMID:26542958]