PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02665.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 438aa    MW: 47188.7 Da    PI: 7.4033
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02665.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.71.9e-52531811128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknrat 78 
                                   +ppGfrFhPt+eel+++yL+kkv++++++l +vi++vd++k+ePwd+++  k+ +  +++wyfFs++dkky+tg+r+nrat
  Zmw_sc02665.1.g00010.1.am.mk  53 VPPGFRFHPTEEELLNYYLRKKVASQEIDL-DVIRDVDLNKLEPWDIQEkcKIGSgPQNDWYFFSHKDKKYPTGTRTNRAT 132
                                   69****************************.9***************952444443456********************** PP

                           NAM  79 ksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   ++g+Wkatg+dk++++   + +g++ktLvfykgrap+g+k+dW+mheyrl
  Zmw_sc02665.1.g00010.1.am.mk 133 AAGFWKATGRDKAIYN-AVKRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 181
                                   ****************.8899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.06E-5847215IPR003441NAC domain
PROSITE profilePS5100556.79453215IPR003441NAC domain
PfamPF023655.0E-2854181IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    Send to blast
MIGQSSLHVR WLPLQSLGWG YRPAIAEALH NCRAFFFPSR VPVRHQTLPH SCVPPGFRFH  60
PTEEELLNYY LRKKVASQEI DLDVIRDVDL NKLEPWDIQE KCKIGSGPQN DWYFFSHKDK  120
KYPTGTRTNR ATAAGFWKAT GRDKAIYNAV KRIGMRKTLV FYKGRAPHGQ KSDWIMHEYR  180
LDDPADAAST VTAAAVASSD AGQEDGWVVC RVFKKKHHVK ESGSGSGGGK HGHHHGGGGD  240
HGSKMAAAHG HGLQYSSSDD ALDQILQYMG RSCKQEHEIL SPSAGGAGRP AGSRCHLRPI  300
ETVLGEHGFM KLPPLESPSA ATTALTPLPP HVPGEAAASS GGDDLLLHRG GNGITDWAMM  360
DRLVASHLNG QAPDAPVDHQ LCCFDGGDDD AGSADGLAFY SAAATRLLSG GSGSGASDDD  420
LWSFARSAAS SSTERLIG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-474821612166NO APICAL MERISTEM PROTEIN
1ut4_B2e-474821612166NO APICAL MERISTEM PROTEIN
1ut7_A2e-474821612166NO APICAL MERISTEM PROTEIN
1ut7_B2e-474821612166NO APICAL MERISTEM PROTEIN
3swm_A3e-474821615169NAC domain-containing protein 19
3swm_B3e-474821615169NAC domain-containing protein 19
3swm_C3e-474821615169NAC domain-containing protein 19
3swm_D3e-474821615169NAC domain-containing protein 19
3swp_A3e-474821615169NAC domain-containing protein 19
3swp_B3e-474821615169NAC domain-containing protein 19
3swp_C3e-474821615169NAC domain-containing protein 19
3swp_D3e-474821615169NAC domain-containing protein 19
4dul_A2e-474821612166NAC domain-containing protein 19
4dul_B2e-474821612166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator of genes involved in biosynthesis of secondary walls. Together with NST2 and NST3, required for the secondary cell wall thickening of sclerenchymatous fibers, secondary xylem (tracheary elements), and of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues. {ECO:0000269|PubMed:16214898, ECO:0000269|PubMed:17237351, ECO:0000269|PubMed:17333250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020164672.11e-173NAC domain-containing protein 43-like
SwissprotQ84WP61e-110NAC43_ARATH; NAC domain-containing protein 43
TrEMBLA0A3B6RKJ31e-177A0A3B6RKJ3_WHEAT; Uncharacterized protein
TrEMBLA0A446XJ841e-177A0A446XJ84_TRITD; Uncharacterized protein
STRINGMLOC_66924.21e-173(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP159738112
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Gondolf VM, et al.
    A gene stacking approach leads to engineered plants with highly increased galactan levels in Arabidopsis.
    BMC Plant Biol., 2014. 14: p. 344
    [PMID:25492673]
  3. Jaradat MR,Ruegger M,Bowling A,Butler H,Cutler AJ
    A comprehensive transcriptome analysis of silique development and dehiscence in Arabidopsis and Brassica integrating genotypic, interspecies and developmental comparisons.
    GM Crops Food, 2014. 5(4): p. 302-20
    [PMID:25523176]
  4. Yuan Y,Teng Q,Zhong R,Ye ZH
    TBL3 and TBL31, Two Arabidopsis DUF231 Domain Proteins, are Required for 3-O-Monoacetylation of Xylan.
    Plant Cell Physiol., 2016. 57(1): p. 35-45
    [PMID:26556650]
  5. Yang C, et al.
    Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation.
    Plant Physiol., 2017. 175(1): p. 333-350
    [PMID:28724622]
  6. Pascual MB, et al.
    PpNAC1, a main regulator of phenylalanine biosynthesis and utilization in maritime pine.
    Plant Biotechnol. J., 2018. 16(5): p. 1094-1104
    [PMID:29055073]
  7. Liu C,Yu H,Li L
    SUMO modification of LBD30 by SIZ1 regulates secondary cell wall formation in Arabidopsis thaliana.
    PLoS Genet., 2019. 15(1): p. e1007928
    [PMID:30657769]