PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02607.1.g00080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LBD
Protein Properties Length: 464aa    MW: 49654 Da    PI: 5.0389
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02607.1.g00080.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260122.32.6e-381342331100
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   aCaaCk++rrkC++dC+lapyfpa+q+++f n+h+lFG+sn+lk+l+ l+++   +am++l+++Ae+r++dPv G++++il
  Zmw_sc02607.1.g00080.1.am.mk 134 ACAACKYQRRKCNSDCPLAPYFPADQQRRFLNAHRLFGVSNILKTLRGLRPDLCAEAMNTLIFQAEMRVQDPVGGCYRLIL 214
                                   7******************************************************************************** PP

                        DUF260  82 klqqqleqlkaelallkee 100
                                    l++q+e ++aela+++++
  Zmw_sc02607.1.g00080.1.am.mk 215 GLERQIEIERAELAAVHHH 233
                                   ****************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.178133234IPR004883Lateral organ boundaries, LOB
PfamPF031955.3E-36134231IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    Send to blast
MDPLSIFSLA KNGASKRAWR WINGADSPLA LSCSYSYDDG AGAASPSPHL ARASPLPAPP  60
PARAPRSATM TSASSSTGAA AAHAPHLHIS TNPTTALPSS SYCNKLSSGK ASGSHSPRGT  120
GSSGSGGSGS ANQACAACKY QRRKCNSDCP LAPYFPADQQ RRFLNAHRLF GVSNILKTLR  180
GLRPDLCAEA MNTLIFQAEM RVQDPVGGCY RLILGLERQI EIERAELAAV HHHLALCRQA  240
AAMPPKPGDF DVTSSNQAPL LLNADQDVVV DALYSNHHHE VLQKTEGHPH EDHQGHSPQQ  300
HGELFDYFYY DTAAAVDDGS SKPAALAINV DAMSEFGYGE DQKLDINVHD ELATGQQQQQ  360
LLDVNCHLDR NDYEVKAAPL LVDVFDMRQQ GVDVNADDID VKAVVDVNAD INIDINAVGA  420
NAEVDLNEEL QENDTNNNIA TCEAVQCSVE PSQCKPEGLA FSAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-221312348111LOB family transfactor Ramosa2.1
5ly0_B1e-221312348111LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025820222.11e-119uncharacterized protein LOC112896465
TrEMBLA0A1E5VM401e-121A0A1E5VM40_9POAL; LOB domain-containing protein 22
STRINGSb07g019940.11e-114(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52283461