PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02600.1.g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GATA
Protein Properties Length: 133aa    MW: 15096.6 Da    PI: 12.0084
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02600.1.g00020.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA28.42.3e-092356134
                          GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34
                                  C +C + kTp+WR      +tLCnaC ++ r  +
  Zmw_sc02600.1.g00020.1.am.mk 23 CLQCDSAKTPQWRLRLLRRSTLCNACDVRLRADR 56
                                  899***********************99988766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011410.6731771IPR000679Zinc finger, GATA-type
SMARTSM004017.6E-51768IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.28E-81964No hitNo description
Gene3DG3DSA:3.30.50.101.9E-81972IPR013088Zinc finger, NHR/GATA-type
PfamPF003203.4E-72356IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 133 aa     Download sequence    Send to blast
MPSLSDIAAA SSMVRLTKKM KRCLQCDSAK TPQWRLRLLR RSTLCNACDV RLRADRVLRE  60
TKQRAAQRRA RHAAACGAGL NGSGQARVKD HQPATLFLQV DLHRRCGYRV VHQVQGGVDQ  120
QVARRRRPCH MQQ
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2494125