PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02594.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 663aa    MW: 73255.7 Da    PI: 6.3645
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02594.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM129.52.5e-40401437128
                           NAM   7 FhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                                   FhPtdeel+ +yLk+k++g+++el e+i+evd+yk+ePwdLp                d+ky++g+r+nratksgyWkatg
  Zmw_sc02594.1.g00030.1.am.mk  40 FHPTDEELIIYYLKRKINGRQIEL-EIIPEVDLYKCEPWDLP----------------DRKYPNGSRTNRATKSGYWKATG 103
                                   ************************.99**************9................789******************** PP

                           NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   kd++v s ++++vg+kktLv+y+grap+g++tdWvmheyrl
  Zmw_sc02594.1.g00030.1.am.mk 104 KDRNVNS-HRRAVGMKKTLVYYRGRAPHGSRTDWVMHEYRL 143
                                   ******9.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100542.96634166IPR003441NAC domain
SuperFamilySSF1019417.45E-5039166IPR003441NAC domain
PfamPF023654.4E-2140143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 663 aa     Download sequence    Send to blast
MQLAHASRPG KIYMGARSLP FWFPSLSIEL LPPASAISWF HPTDEELIIY YLKRKINGRQ  60
IELEIIPEVD LYKCEPWDLP DRKYPNGSRT NRATKSGYWK ATGKDRNVNS HRRAVGMKKT  120
LVYYRGRAPH GSRTDWVMHE YRLDERECET DTGLQDAYAL CRVFKKTAPG PKIMEHYGAV  180
QHPIEQPQWT ACNVDHRSPT LDLSCDVRGD DFESTSFSFP AEAPMDYTHG GFGMQMSASH  240
EDGKWMQFLS EDAFNATNNP FFTNPASSSF SCIPSKVDVA LECARLQHRL SLPPLEVEDF  300
PHGVSLDTKA GVLRSNPNEV DILQEFLSVA SASQELINGS SSSYAAEMWP GAGSSNVSTH  360
YGNELSSLVE LGVKAKVEAD NFYHIEGCVG TSSSGFALKS GHVDEPVRLV EISEMEEELK  420
EEKKQVENLR GVRLHNNDLG EIAGEAGHLT DPTDADGGLD TAPIFSQSQP DDFAIGFDDV  480
DNPSASFELY EKVDVKHAGL FVSRVGAAKT FFHRVEPSKK VSFHLSPVAS DVSKAIEKFH  540
FPVNVTTKVS GRVSIFSKFK ALIRDKFLMK PSYQRSIGSK EAAAGSELLN IVTLLLTPKE  600
ATGPAAEQEL VMRKVMKPGS CCDGNTVWLP LSKGSKGISS MFLSGKWAFL TSALAIRSPG  660
CNH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-393117217171NO APICAL MERISTEM PROTEIN
1ut4_B1e-393117217171NO APICAL MERISTEM PROTEIN
1ut7_A1e-393117217171NO APICAL MERISTEM PROTEIN
1ut7_B1e-393117217171NO APICAL MERISTEM PROTEIN
4dul_A1e-393117217171NAC domain-containing protein 19
4dul_B1e-393117217171NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002468623.10.0uncharacterized protein LOC8085734
TrEMBLK4A6N60.0K4A6N6_SETIT; Uncharacterized protein
STRINGSi034541m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP66243651