PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02592.1.g00100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HSF
Protein Properties Length: 109aa    MW: 12313 Da    PI: 8.2578
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02592.1.g00100.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind78.98e-253897261
                                  HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTT CS
                  HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYg 61
                                  Fl+k+y++++d++++ ++sws ++nsfvv+d++ f + +Lp+yFkh+nf+SFvRQLn+Y+
  Zmw_sc02592.1.g00100.1.sm.mk 38 FLTKTYDMIDDPTTDAVVSWSCTNNSFVVWDPHIFGTVLLPRYFKHNNFSSFVRQLNTYE 97
                                  9********************888***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.101.6E-263297IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004155.0E-2434109IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467851.36E-233697IPR011991Winged helix-turn-helix DNA-binding domain
PRINTSPR000563.6E-163861IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004476.2E-213897IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000563.6E-167688IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000563.6E-1689101IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 109 aa     Download sequence    Send to blast
MNHRMVNPVK VESQQSLGAA NGHPLPMDGL HDGGPPPFLT KTYDMIDDPT TDAVVSWSCT  60
NNSFVVWDPH IFGTVLLPRY FKHNNFSSFV RQLNTYEKRG HCKADLVKK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5u_B7e-1936992790Heat shock factor protein 1
5d5v_B7e-1936992790Heat shock factor protein 1
5d5v_D7e-1936992790Heat shock factor protein 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981438.23e-56PREDICTED: heat stress transcription factor A-2e-like
SwissprotQ6F3883e-56HFA2E_ORYSJ; Heat stress transcription factor A-2e
TrEMBLK4AC793e-56K4AC79_SETIT; Uncharacterized protein
STRINGSi036486m1e-55(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30837231