PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02571.1.g00130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 355aa    MW: 38293.1 Da    PI: 9.0757
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02571.1.g00130.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.78.1e-52241561128
                             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratk 79 
                                     lppGfrFhPtdeel+ +yL+k++++ ++++  vi+evdiyk++PwdLp+k+  +e ewyfFs+rd+ky++g r+nra+ 
  Zmw_sc02571.1.g00130.1.sm.mkhc  24 LPPGFRFHPTDEELILYYLRKRAASAPCPA-PVIAEVDIYKFDPWDLPAKAVFGEGEWYFFSPRDRKYPNGVRPNRAAG 101
                                     79***************************9.89***************87778899*********************** PP

                             NAM  80 sgyWkatgkdkevlsk......kgelvglkktLvfykgrapkgektdWvmheyrl 128
                                     sgyWkatg+dk+++++      +++ +g+kk Lvfykgr pkg+kt+W+mheyrl
  Zmw_sc02571.1.g00130.1.sm.mkhc 102 SGYWKATGTDKPITHSaaaptdRSAMIGVKKALVFYKGRPPKGTKTTWIMHEYRL 156
                                     ***************98888877778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-6322189IPR003441NAC domain
PROSITE profilePS5100560.57524189IPR003441NAC domain
PfamPF023656.2E-2725156IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009825Biological Processmultidimensional cell growth
GO:0009835Biological Processfruit ripening
GO:0009908Biological Processflower development
GO:0010150Biological Processleaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MTIELALAAA PSSSSAGGGM PRPLPPGFRF HPTDEELILY YLRKRAASAP CPAPVIAEVD  60
IYKFDPWDLP AKAVFGEGEW YFFSPRDRKY PNGVRPNRAA GSGYWKATGT DKPITHSAAA  120
PTDRSAMIGV KKALVFYKGR PPKGTKTTWI MHEYRLADAL NAANTYRPMR LKNASMRLDD  180
WVLCRIYKKT NPQLTYSSSP PLDAEISMDG VQGHQQDGSI FADVAVAAAA YGSSAGRLPR  240
PPSISDYLVD YSAVSELFDN IPAPQLGTTD TGSSSGAGAA AHQFLLGSNS QASGLSSVAP  300
QLSSHKRQLI EDYSNSSVEM LQASNNKRAL SDASMAVNNS FSMFGPGYPS LQDRI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-702419115170Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence (developmental, light-induced and ABA-induced senescence) and regulates fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. Activates the expression of senescence and ABA associated genes including NCED1, ABCG40, CYP707A2, SAG113, SGR1 and PAO, by directly binding to their promoters. {ECO:0000269|PubMed:29760199}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00221DAPTransfer from AT1G69490Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. Induced by abscisic acid (ABA). {ECO:0000269|PubMed:29760199}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025816084.11e-140NAC transcription factor 29-like
SwissprotK4BNG72e-88NAP2_SOLLC; NAC domain-containing protein 2
TrEMBLA0A1E5UWU91e-144A0A1E5UWU9_9POAL; NAC transcription factor NAM-B2
STRINGPavir.Ea00837.1.p1e-135(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123736123
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  2. Ma X, et al.
    The NAC Transcription Factor SlNAP2 Regulates Leaf Senescence and Fruit Yield in Tomato.
    Plant Physiol., 2018. 177(3): p. 1286-1302
    [PMID:29760199]