PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02449.1.g00080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LBD
Protein Properties Length: 212aa    MW: 22846 Da    PI: 8.1413
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02449.1.g00080.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260121.25.8e-38171271100
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkal...........peeeredamsslvyeAearar 70 
                                   +Ca+Ck+lrr+C+++Cv+apyfp e+p+kfa+vhk+FGasnv+k+l+             p ++r da+sslvyeA+ar+r
  Zmw_sc02449.1.g00080.1.sm.mk  17 PCASCKLLRRRCTQECVFAPYFPPEDPRKFAIVHKVFGASNVSKMLQVRpaasiivmhelPAQQRADAVSSLVYEANARMR 97 
                                   7*******************************************98743222333333339999***************** PP

                        DUF260  71 dPvyGavgvilklqqqleqlkaelallkee 100
                                   dPvyG++g i+ lqqq++ql+ +lal+k+e
  Zmw_sc02449.1.g00080.1.sm.mk  98 DPVYGCAGAISYLQQQVSQLQMQLALAKAE 127
                                   **************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.11316128IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-3817125IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MAGNGSSIGG SSSSSPPCAS CKLLRRRCTQ ECVFAPYFPP EDPRKFAIVH KVFGASNVSK  60
MLQVRPAASI IVMHELPAQQ RADAVSSLVY EANARMRDPV YGCAGAISYL QQQVSQLQMQ  120
LALAKAEILM HHNDGQLLGH SAAAPSSTKQ QQLQQQQMDA LQDYGSMFMQ NGLTDTLNTA  180
AAAAHQQQFL SSGFGSGGML HETCLKKESL WA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-451714811130LOB family transfactor Ramosa2.1
5ly0_B1e-451714811130LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014661028.11e-78LOB domain-containing protein 12
SwissprotQ8LBW31e-58LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A368S2P53e-77A0A368S2P5_SETIT; Uncharacterized protein
STRINGSi026864m1e-74(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]