PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02447.1.g00040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 1042aa    MW: 112104 Da    PI: 9.8578
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02447.1.g00040.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP75.96.4e-24289337250
                                   -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEE CS
                           SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfh 50 
                                   C vegC+adls++++yhrrhkvCe+hsk+pvv+v+g++qrfCqqCsr+ 
  Zmw_sc02447.1.g00040.1.am.mk 289 CAVEGCAADLSKCRDYHRRHKVCEAHSKTPVVIVAGQQQRFCQQCSRYA 337
                                   ***********************************************85 PP

2SBP43.87e-144094404778
                                   SSEEETTT--SS--S-STTTT-------S--- CS
                           SBP  47 srfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                                   s fh l efDe krsCr+rL++hn+rrrk q+
  Zmw_sc02447.1.g00040.1.am.mk 409 SSFHLLGEFDEIKRSCRKRLDGHNRRRRKVQP 440
                                   88***************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.9E-24281336IPR004333Transcription factor, SBP-box
PROSITE profilePS5114118.802286368IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.24E-22287337IPR004333Transcription factor, SBP-box
PfamPF031101.2E-16289336IPR004333Transcription factor, SBP-box
PROSITE profilePS5114110.545360438IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.23E-10409442IPR004333Transcription factor, SBP-box
PfamPF031101.2E-6409437IPR004333Transcription factor, SBP-box
PfamPF118201.0E-309751040IPR021775Protein of unknown function DUF3339
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1042 aa     Download sequence    Send to blast
MNAHQCTAAV IVRKATKSAF GHVVDSFRPV TCSDDDRPRQ RALLLLFYSP SPQHLPCLVV  60
VQKDSFHPPR KEKPNPERQR LHAARSGGKH QSRGILPLVS RFSAFCSLHM AVPLLAIIAT  120
FGVWGPPIGV HFCCAVCATT VPFLPPPSIY LSIRTSSPTL LAQASQAFWA WCLLPPSIPS  180
SSSSIHPIRE FLEAKGFCLL FLDRSSGIVV VKGLRSPLLM DWDAKMPSWD LGTVVGPSSG  240
NGGGGGTLDL KLGRPTSWKA AAPLPPPPSS SAPAKRPRSG RAQQAVPACA VEGCAADLSK  300
CRDYHRRHKV CEAHSKTPVV IVAGQQQRFC QQCSRYARTL TGPEETLVEL AATTRARASW  360
ASPQQRNDAA GAVELDSWVD ASGRFQGSRG QQIQLCSPMC VRVSLSSLSS FHLLGEFDEI  420
KRSCRKRLDG HNRRRRKVQP DPLNPAGLFA NHHGMTRFAA YPQLFSSPSM ADSKWPATVV  480
KTEASAFKDH YNPALHLGNG AASILNGKDK KHFPFLTPHG DDAALGCQPF TITSSAESSS  540
KQSNGNCALS LLSDNQTPAQ LMIPTGQPLG AALQYGNAAG LPGDLGVSLA GMSYDESRRP  600
LVDVVGGDVG GGGCCCRFNR RRRDLVLVRL RDTHQRSARP ALHVDVGIGD AEADGGKRSL  660
ALHRGENQPG RCTRQAGTIG SPWRDQLLSG RSLEFRDETA EHTYARRPPT MPVRWPRVQD  720
LRGTSPGSRP APNVYLMFLT QRHDPVPDRK RPGIDEGGRR QDEGTDLSTF SLVPIRSVFL  780
PPSRAASDSP LIVDRRYSSK LETRSARIHL TSPEKNEAMT ATNGARGGEE HYSRLMRELC  840
ALLVTIISSS AVSPGQPRQR PSPAAVVSML LGASMALMLC GSVTFAVGLL LVPWVAGLAL  900
LGGFAGAVST LASGATELQK TICLVQATGK KANQDALLCS CRAAKIVWIS GEVRVSCCRE  960
GVSSQKGEMN GGPSTDWGPI IVAVILFVVL SPGLLFQLPA RTRVLEFGNM ATSAIAILVH  1020
AIIFFCLLTI FVVAIGVHIY AA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A1e-17289336653squamosa promoter-binding protein-like 12
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP104563038