PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02444.1.g00050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family TCP
Protein Properties Length: 313aa    MW: 32038.4 Da    PI: 9.4829
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02444.1.g00050.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP80.44.9e-25181228249
                           TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktie 49 
                                   +++k++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++ti+
  Zmw_sc02444.1.g00050.1.am.mk 181 TVAKRPSKDRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGETID 228
                                   5789*******************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.4E-19187228IPR005333Transcription factor, TCP
PROSITE profilePS5136917.431187241IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
LAALRSLSLL PAAPPRPPRR LXXXPPPSCV PGTCSYHRLP PHRVTPPPEA KGAAFPFRSV  60
SSVKGKALWP SLAATRPSRG RTMDHGGGGG APSSSNSAGA SAGGGGTSGS RGGEPQQHPH  120
HAFYYTGPAA PAGSNSGVPP PPPSQQQASP FAGALAITPV PAGDQAQPSA DKKAVVAAAG  180
TVAKRPSKDR HTKVDGRGRR IRMPALCAAR VFQLTRELGH KSDGETIDGT TVQAPLQFMS  240
RAAAYPTAGG GNDTNLGMFA AVNPYNRGAN EDQQHEAEQQ RQRGGGDGGA AEDEEDGDDS  300
GEENHGGDNN SSQ
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49342652