PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02438.1.g00090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 177aa    MW: 19217.8 Da    PI: 9.0357
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02438.1.g00090.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP73.53.7e-23109160152
                                   --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEET CS
                           SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhel 52 
                                   +Cq+egC+adls ak+yhrrhkvCe h+ka+vv++ g++qrfCqqCsr + +
  Zmw_sc02438.1.g00090.1.sm.mk 109 RCQAEGCKADLSGAKHYHRRHKVCEYHAKASVVTAGGKQQRFCQQCSRSYPM 160
                                   6***********************************************7765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.1E-24102158IPR004333Transcription factor, SBP-box
PROSITE profilePS5114119.503107177IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.36E-23108168IPR004333Transcription factor, SBP-box
PfamPF031108.8E-18110160IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MSGRLNAVTS VAGNDFAFAP SMQQPPYLGF DHGVEGGGGS GIGQRAMQNH LYESLDFAAA  60
AAMQIGLNLG RRTYFSPGDM LAVDRLLMRS RLGGVFGLGF GGAHHQPPRC QAEGCKADLS  120
GAKHYHRRHK VCEYHAKASV VTAGGKQQRF CQQCSRSYPM QGRQQCQYVL AFDMDMV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A6e-16110161657squamosa promoter-binding protein-like 12
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965676.11e-51squamosa promoter-binding-like protein 10
SwissprotA2YFT94e-49SPL10_ORYSI; Squamosa promoter-binding-like protein 10
SwissprotQ0DAE84e-49SPL10_ORYSJ; Squamosa promoter-binding-like protein 10
TrEMBLA0A453T2V72e-50A0A453T2V7_AEGTS; Uncharacterized protein
TrEMBLK3XXA13e-50K3XXA1_SETIT; Uncharacterized protein
STRINGPavir.Da00293.1.p8e-58(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23753593