PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02437.1.g00100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 208aa    MW: 23140.6 Da    PI: 6.6366
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02437.1.g00100.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.48.2e-1019601152
                                    HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                          bZIP_1 11 qkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52
                                    ++NR +A rs +RK  +i eLe+kv++L++e ++L  +l   
  Zmw_sc02437.1.g00100.1.am.mkhc 19 ASNRQSAARSKERKARYITELERKVQTLQTEATTLSAQLTLF 60
                                    79*********************************9988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.2E-81373IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.27E-91964No hitNo description
PfamPF001708.6E-81961IPR004827Basic-leucine zipper domain
CDDcd147031.22E-182063No hitNo description
Gene3DG3DSA:1.20.5.1702.0E-92067No hitNo description
PROSITE profilePS502179.0252174IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MGADDDWEKG GGLKVTSSAS NRQSAARSKE RKARYITELE RKVQTLQTEA TTLSAQLTLF  60
QRDTTGLSTE NAELKIRLQA MEQQAQLRDA LNDALKQELE RLKLATGEVT NSDDTYNMRF  120
QHVPYNSSFF PFSQQNTAQH QGSVQLPPAF HPPHNVPNHH MISHPNTLQD IMQQDSIGRF  180
QGLDIGKGPP IVKSESSSIS ASESSSNF
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication. {ECO:0000269|PubMed:14704272}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004984459.11e-106transcription factor RF2b
SwissprotQ6S4P44e-98RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A0A9ITV01e-106A0A0A9ITV0_ARUDO; Uncharacterized protein
TrEMBLA0A1E5USX91e-106A0A1E5USX9_9POAL; Transcription factor RF2b
STRINGPavir.Ib01574.1.p1e-107(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26833683
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Dai S,Zhang Z,Bick J,Beachy RN
    Essential role of the Box II cis element and cognate host factors in regulating the promoter of Rice tungro bacilliform virus.
    J. Gen. Virol., 2006. 87(Pt 3): p. 715-22
    [PMID:16476995]
  3. Liu Y,Dai S,Beachy RN
    Role of the C-terminal domains of rice (Oryza sativa L.) bZIP proteins RF2a and RF2b in regulating transcription.
    Biochem. J., 2007. 405(2): p. 243-9
    [PMID:17371296]
  4. Dai S, et al.
    Transgenic rice plants that overexpress transcription factors RF2a and RF2b are tolerant to rice tungro virus replication and disease.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(52): p. 21012-6
    [PMID:19104064]