PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02435.1.g00170.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 322aa    MW: 36665.8 Da    PI: 7.1487
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                                    XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHH CS
                          bZIP_1  2 kelkrerrkqkNReAArrsRqRKkaeieeLee 33
                                    +++k+ rr+++NReAAr+sR+RKka+i++Le+ 32 PPDKVLRRLAQNREAARKSRLRKKAYIQQLET 63
                                    5799**************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA: hitNo description
SMARTSM003388.1E-73195IPR004827Basic-leucine zipper domain
PfamPF001704.0E-103364IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.27E-73568No hitNo description
PROSITE patternPS0003603853IPR004827Basic-leucine zipper domain
PfamPF141442.4E-28121195IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator involved in defense response. {ECO:0000250|UniProtKB:Q7X993}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025823704.10.0transcription factor TGAL6-like isoform X2
RefseqXP_025823705.10.0transcription factor TGAL6-like isoform X2
SwissprotA0A0P0WFC81e-160TGAL6_ORYSJ; Transcription factor TGAL6
TrEMBLA0A0A9D9I60.0A0A0A9D9I6_ARUDO; Uncharacterized protein
STRINGPavir.Ga00349.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
  2. Okada A, et al.
    OsTGAP1, a bZIP transcription factor, coordinately regulates the inductive production of diterpenoid phytoalexins in rice.
    J. Biol. Chem., 2009. 284(39): p. 26510-8
  3. Okada K
    The biosynthesis of isoprenoids and the mechanisms regulating it in plants.
    Biosci. Biotechnol. Biochem., 2011. 75(7): p. 1219-25
  4. Yamane H
    Biosynthesis of phytoalexins and regulatory mechanisms of it in rice.
    Biosci. Biotechnol. Biochem., 2013. 77(6): p. 1141-8
  5. Miyamoto K, et al.
    Identification of target genes of the bZIP transcription factor OsTGAP1, whose overexpression causes elicitor-induced hyperaccumulation of diterpenoid phytoalexins in rice cells.
    PLoS ONE, 2014. 9(8): p. e105823
  6. Miyamoto K, et al.
    Overexpression of the bZIP transcription factor OsbZIP79 suppresses the production of diterpenoid phytoalexin in rice cells.
    J. Plant Physiol., 2015. 173: p. 19-27