PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02412.1.g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 526aa    MW: 57781.3 Da    PI: 9.4103
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02412.1.g00020.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.81.3e-502593841128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   lppGfrFhPtdeelv +yL+++++g+  ++  +i+e+d+y+++Pw+Lp+++  +++ewyfF++rd+ky++g+r+nra+ +g
  Zmw_sc02412.1.g00020.1.am.mk 259 LPPGFRFHPTDEELVLHYLCARAAGRGAPV-PIIAELDLYRFDPWELPARALFGRREWYFFTPRDRKYPNGSRPNRAAGTG 338
                                   79*************************999.88***************87778999************************* PP

                           NAM  82 yWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   yWkatg dk+v + +g++vg+kk Lvfy+g+ p+g+kt+W+mheyrl
  Zmw_sc02412.1.g00020.1.am.mk 339 YWKATGADKPVAH-RGRTVGVKKALVFYHGKPPRGVKTEWIMHEYRL 384
                                   *************.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.07E-62255411IPR003441NAC domain
PROSITE profilePS5100559.369259411IPR003441NAC domain
PfamPF023656.3E-26260384IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 526 aa     Download sequence    Send to blast
MICSPLASAS RCDLDLGGHG CCPCARVAMA GGATIGEVVG EAVGEVVGSD GSLEEVTTRR  60
ERWQAGAVRC EKGGERGGAA LGGRGSATRR CRASIAPAGE RDVIPVRFKE PRAREIGLSP  120
SHPKFPIPTT VDAGRCGRFV DPTAAVVNHR RQRGVVSGKR PTSPPNHRAA AVAHQSQLAL  180
TPTRRSFVSL TVSVRLFIPL LSPPHSSPPT SLTDTVSSHR RNARPNPRHH RKEGNNRIYR  240
QEAMAGPARR RDAEAELNLP PGFRFHPTDE ELVLHYLCAR AAGRGAPVPI IAELDLYRFD  300
PWELPARALF GRREWYFFTP RDRKYPNGSR PNRAAGTGYW KATGADKPVA HRGRTVGVKK  360
ALVFYHGKPP RGVKTEWIMH EYRLADDAGR RKPGNGSLRL DDWVLCRLYN KKNEWEKLQQ  420
QQEEERKELE MDASHSQSFG DTRTPESGVD DVDVDQVPAF GDMGAVVPKK EVQEIGDLGG  480
ADDWLAGINL DDLQGLCPVP DDDFFSSLLV TPTAARAELG RHLLKF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-932464172174Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in stress response. {ECO:0000250|UniProtKB:Q7F2L3}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salt and cold stresses (PubMed:18813954, PubMed:20632034). Induced by dehydration and methyl jasmonate (PubMed:20632034). {ECO:0000269|PubMed:18813954, ECO:0000269|PubMed:20632034}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001141629.21e-142uncharacterized protein LOC100273749
SwissprotQ7EZT11e-116NAC67_ORYSJ; NAC domain-containing protein 67
TrEMBLA0A0A9P3S71e-147A0A0A9P3S7_ARUDO; Uncharacterized protein
STRINGGRMZM2G079632_P011e-142(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44143071
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Takasaki H, et al.
    The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice.
    Mol. Genet. Genomics, 2010. 284(3): p. 173-83
    [PMID:20632034]
  3. Ghosh T,Rai M,Tyagi W,Challam C
    Seedling stage low temperature response in tolerant and susceptible rice genotypes suggests role of relative water content and members of OsSNAC gene family.
    Plant Signal Behav, 2016. 11(5): p. e1138192
    [PMID:26829663]
  4. Rahman H,Ramanathan V,Nallathambi J,Duraialagaraja S,Muthurajan R
    Over-expression of a NAC 67 transcription factor from finger millet (Eleusine coracana L.) confers tolerance against salinity and drought stress in rice.
    BMC Biotechnol., 2016. 16 Suppl 1: p. 35
    [PMID:27213684]