PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02357.1.g00160.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 427aa    MW: 46375.1 Da    PI: 4.7254
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02357.1.g00160.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP71.71.3e-22147195149
                                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSE CS
                             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrf 49 
                                     +CqvegCeadl+ ak+yhrrhkvCe+h+ka++++v +  qrfCqqCsr 
  Zmw_sc02357.1.g00160.1.sm.mkhc 147 ACQVEGCEADLTAAKDYHRRHKVCEMHAKASTAVVGNAVQRFCQQCSRL 195
                                     5**********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.5E-24140195IPR004333Transcription factor, SBP-box
PROSITE profilePS5114118.7145222IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.35E-21146195IPR004333Transcription factor, SBP-box
PfamPF031101.1E-16148195IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MEAAGFGAQS SHLYGVGLSE LDLNRRDKRV FGWDLNEWSW DSERFIATPV PASVPNGLEL  60
NSSPSSSEEA EAEVARNDAV RGDPEKRKRV VAIDDDEAEH QDCGGALSLK IGGDAGGPRT  120
VESGNVNEEE KNGKKIKVQG GSSSGPACQV EGCEADLTAA KDYHRRHKVC EMHAKASTAV  180
VGNAVQRFCQ QCSRLICSFE GRCIFQEDTA TITDDAELED RETEYSGFSN SFFPFIIAEQ  240
DTNLFRPDAL GPSTITPLHI AASTSDAEDV LDALTDDPGL VGISAWKNAR DDTGFTPEDY  300
ARQRGNDAYL NLVQKKIDKH TSGAHVVLGV PSSICPVGAD DMKLGDVSLE ICSSMPMAAP  360
MAKCYLCSHQ ARMYSRSSVR TFLYRPAMLM MMGVAVVCVC VGILLHTMPK VYAAPTFRWE  420
LLERGAM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A3e-19144195253squamosa promoter-binding protein-like 12
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003563064.14e-93squamosa promoter-binding-like protein 6
SwissprotQ75LH61e-85SPL6_ORYSJ; Squamosa promoter-binding-like protein 6
TrEMBLA0A3Q8ANR71e-98A0A3Q8ANR7_BAMML; Squamosa-promoter binding protein-like protein
STRINGTraes_4AL_5062917C4.14e-93(Triticum aestivum)
STRINGTRIUR3_33729-P15e-93(Triticum urartu)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19983892
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]