PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02343.1.g00060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 1157aa    MW: 129763 Da    PI: 8.4708
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02343.1.g00060.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM134.76.4e-42201381117
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   lppGfrFhP+dee++++yL +kv ++++++  +i+e+di+++ePw+Lp+k+k +ekewyf++ +d+ky++g+r nrat++g
  Zmw_sc02343.1.g00060.1.am.mk  20 LPPGFRFHPSDEEIITFYLMPKVLNSNFTA-VAIAEADINNSEPWELPRKAKMGEKEWYFYCLKDHKYQKGERINRATNAG 99 
                                   79*************************999.67***************99999**************************** PP

                           NAM  82 yWkatgkdkevlsk...kgelvglkktLvfykgrapkge 117
                                   +Wkatgkdke++++     ++vg+kktLvfy+grap+  
  Zmw_sc02343.1.g00060.1.am.mk 100 FWKATGKDKEIYQAssmMPAVVGMKKTLVFYTGRAPRVY 138
                                   *************84444445**************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-4318139IPR003441NAC domain
PROSITE profilePS5100540.8620167IPR003441NAC domain
PfamPF023651.7E-1821132IPR003441NAC domain
Gene3DG3DSA:1.10.630.107.1E-90173619IPR001128Cytochrome P450
SuperFamilySSF482647.73E-93185618IPR001128Cytochrome P450
PfamPF000678.0E-7188366IPR001128Cytochrome P450
PRINTSPR004631.8E-10220239IPR002401Cytochrome P450, E-class, group I
PfamPF000675.3E-48401598IPR001128Cytochrome P450
PRINTSPR003854.7E-6419436IPR001128Cytochrome P450
PRINTSPR003854.7E-6475486IPR001128Cytochrome P450
PRINTSPR004631.8E-10514538IPR002401Cytochrome P450, E-class, group I
PRINTSPR004631.8E-10557567IPR002401Cytochrome P450, E-class, group I
PRINTSPR003854.7E-6558567IPR001128Cytochrome P450
PROSITE patternPS000860560569IPR017972Cytochrome P450, conserved site
PRINTSPR004631.8E-10567590IPR002401Cytochrome P450, E-class, group I
PRINTSPR003854.7E-6567578IPR001128Cytochrome P450
PfamPF143634.8E-14744819IPR025753AAA-type ATPase, N-terminal domain
SuperFamilySSF525402.63E-44881991IPR027417P-loop containing nucleoside triphosphate hydrolase
Gene3DG3DSA:3.40.50.3002.6E-369131008IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM003823.0E-89301097IPR003593AAA+ ATPase domain
CDDcd000094.14E-89311095No hitNo description
PfamPF000041.5E-79351008IPR003959ATPase, AAA-type, core
SuperFamilySSF525402.63E-4410451135IPR027417P-loop containing nucleoside triphosphate hydrolase
Gene3DG3DSA:3.40.50.3002.6E-3610461092IPR027417P-loop containing nucleoside triphosphate hydrolase
PROSITE patternPS00674010651083IPR003960ATPase, AAA-type, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055114Biological Processoxidation-reduction process
GO:0003677Molecular FunctionDNA binding
GO:0005506Molecular Functioniron ion binding
GO:0005524Molecular FunctionATP binding
GO:0016705Molecular Functionoxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0020037Molecular Functionheme binding
Sequence ? help Back to Top
Protein Sequence    Length: 1157 aa     Download sequence    Send to blast
MGDHKYEGIR GTIDDAGLNL PPGFRFHPSD EEIITFYLMP KVLNSNFTAV AIAEADINNS  60
EPWELPRKAK MGEKEWYFYC LKDHKYQKGE RINRATNAGF WKATGKDKEI YQASSMMPAV  120
VGMKKTLVFY TGRAPRVYRS SEGVWSKALA RSPPMDFSLL LALVAIALPV ILHLVTRAKN  180
PRPAARLPPG SLGVPVIGQS LGLLRAMRNN TAERWIKDQV DRYGPVSKLS LFGAPTVLVT  240
GPAANKFVFF SDALAMRQPR SVQRILGERS ILDLNGADHK RIRGALVEFL KPDMLRMYVG  300
KIDGEVRCHV DECWSGRATV TVMPLMKRLT FDIISSLLFG LERGALRDAL ANDFAGVMEG  360
MCRSLKASAR ARRLLTRITR ETEAKLERGE ATRSSDLIAG ARLLSEEEIV DTSMVALVAG  420
HDTSSILMTF MVRHLANDPD TLAAMVQEHD EIAMSKNKGE ALTWDDLAKM KFTWRVALET  480
LRLVPPIFGN FRTAVKDIEF GGYTILAGWQ VFWTAPVTHT DAAIFPDPAK FDPSRFESHQ  540
PSAAATTAKA KAPPFSFVAF GGGARICVGM EFARIETLVT MHHLVRRFQW RLCCKEDTFA  600
RDPMPSPLHG LPVEIEQRTY QIRAQHSTRR SRGSMDRLPL TVAAAAPRPQ VRTVLDAYKK  660
ALATAASMTA YAVLARSMAR ELLPDELRFA VRWAAALVRA RFGGDETQKE RQRHTIVIQQ  720
QYDTGHGENR LFDSARTYLA SRQYDTGHGE NRLFDSARTY LASRVDPRAM SRLCLTGSYS  780
YSNDGSSTSS SSWSTQLHME AGASTTDTFD GVEFTWTSVE TAGEDSKKMK RKGGDGRGES  840
LELSFDAEHT DMALERYVPF VMATAEELQR RDQPLRIYMN EGPSWRGINH HHPATFDTLA  900
MDPELKQSVI ADLDRFLKRK DYYRRIGKAW KRGYLLYGPP GTGKSTLVAA MANYLRFSLY  960
DLDLSMVQFN SVLQTLLIAM PNKSILVIED IDCCFDAVSR EDDKDGKTAE PNDGLDSGNN  1020
PYIYSYGAPP VPAHRTTTSL RGRGITLSGL LNFIDGLWST TGEERVIVFT TNYKDRLDPA  1080
LLRPGRMDMH VHMTLARNYF RVDDHALFPE IQALLSQVEV TPAEVSEMLL RSEDVEFLQE  1140
KRRTTMEEAE DKEDAMY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6a17_A9e-531756001435Cytochrome P450 90B1
6a18_A9e-531756001435Cytochrome P450 90B1
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1369376RARRLLTR
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54123