PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02337.1.g00100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 474aa    MW: 51192.8 Da    PI: 10.8046
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02337.1.g00100.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP379e-12428470244
                                   -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-T CS
                           SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCq 44 
                                   C  ++ +adls+ ++yhrr kvCe+h k+ vv+v+g+e  fC 
  Zmw_sc02337.1.g00100.1.am.mk 428 CALDESKADLSNYQDYHRRRKVCETHCKTLVVFVAGREMLFCP 470
                                   999***************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.0E-13420470IPR004333Transcription factor, SBP-box
PROSITE profilePS5114112.964425474IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.09E-10426471IPR004333Transcription factor, SBP-box
PfamPF031109.8E-9428469IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 474 aa     Download sequence    Send to blast
MQKLGRNAAT IRASAATKTP QLNLDPPAAT AAATRTRQCP LNPGQERANS LTCTRAIAAA  60
AIPRRRPTGA IPSHRLAVEP SRHHEMPRLT GWGRQGGGSR DWCWEVWTFL ERSEPPPPRY  120
NAEGGRAAHE LAVAPPHAGL KNTAEEANGI SSPVFTTSSS SARASVLPIS RPPNLRERLG  180
LGPRPGSSRF LLVERSALLA LDWWVELAAN QSAPVTCPAR EVTAAYPHRR SSIQTHWPAS  240
AREKIIPDAS LWPVGTGRAA GWIWEPENEA AAPRDGTGRL LRPNRKKNLQ RLRGARPVRW  300
PRPAEAVAVL GATATPRRAG EVVAYTSGHA VTALWKFGFS LANAPSLRLL PHSQITDEGG  360
GLESVVTAGG WNVEHGAVWT SRSSGASSTG GPGSADLKLG GVDEYELSDG GRRLARDRQK  420
HGQQCPSCAL DESKADLSNY QDYHRRRKVC ETHCKTLVVF VAGREMLFCP TSPR
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3281722