PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02328.1.g00040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 1528aa    MW: 165281 Da    PI: 9.2239
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02328.1.g00040.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.56.1e-1359119161
                                   XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                                   +ke +r +r+ +NR++A+  R+R ka++ eLe +vk Le++N++L ++l++l++e + l++
  Zmw_sc02328.1.g00040.1.am.mk  59 DKEHRRLKRLLRNRVSAQQARERNKAYLSELEVRVKDLEKQNSELEERLSTLQNENQMLRQ 119
                                   58899***************************************************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.3E-1459123IPR004827Basic-leucine zipper domain
PfamPF001701.4E-1160119IPR004827Basic-leucine zipper domain
PROSITE profilePS5021712.41561124IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.5E-1463122No hitNo description
SuperFamilySSF579596.19E-1163121No hitNo description
PROSITE patternPS0003606681IPR004827Basic-leucine zipper domain
CDDcd147044.57E-1673115No hitNo description
PfamPF035524.8E-2412991007IPR005150Cellulose synthase
SuperFamilySSF534485.06E-6312361IPR029044Nucleotide-diphospho-sugar transferases
SuperFamilySSF534485.06E-6467670IPR029044Nucleotide-diphospho-sugar transferases
PROSITE profilePS500966.54963989IPR000048IQ motif, EF-hand binding site
SuperFamilySSF525408.06E-2613341463IPR027417P-loop containing nucleoside triphosphate hydrolase
Gene3DG3DSA:3.40.50.3009.9E-3213341461IPR027417P-loop containing nucleoside triphosphate hydrolase
PROSITE profilePS511959.41813501378IPR014014RNA helicase, DEAD-box type, Q motif
PfamPF002702.4E-1513741460IPR011545DEAD/DEAH box helicase domain
PROSITE profilePS5119210.45213811528IPR014001Helicase superfamily 1/2, ATP-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0030244Biological Processcellulose biosynthetic process
GO:0016020Cellular Componentmembrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0005524Molecular FunctionATP binding
GO:0016760Molecular Functioncellulose synthase (UDP-forming) activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1528 aa     Download sequence    Send to blast
MESDEEIRRV PEFGAAEQHA GPSTSGKQTA AGTAAATGTS SYATQPAATA HRSGRSPADK  60
EHRRLKRLLR NRVSAQQARE RNKAYLSELE VRVKDLEKQN SELEERLSTL QNENQMLRQV  120
LKSTAVNRRA PGGSSTDKLP RKHRWEYGVA SVPAKLFSIT AKRYATMNCP RVNKMDDGSV  180
EMVPAPPNSP EHEPASSAKC GDGLVEPLTS ELPIPAVELN LYRAAVALRA VLLAVLFRYR  240
VVRPVPDAPW LWRTAVVCEL WLALAWLVAQ LPKLSPTNSA THLDRLASRY DDEHELPGVD  300
VLVTAADAGR EPPLATANTV LSVLAADYPA GRLACYVSDD GADMLTFEAL FEAARFARRW  360
VPFCRRHGVE PRAPELYFAR GVDYLRDRAS PSFVKERRAT KREYEEFKVR MNYLVAKARK  420
VPEDGWVMSD GTPWPGNNPR DHPAMIQVLV GHPGDQDAEG HELPRLFYVS REKRPGFQHY  480
KKAGALNALL RVSALLTNGA YVLNLDYNHC VSNSGALREA MCFLVDPLAG NRTCFVQFPL  540
RIGVDDDGDD SQNVSRASVF FDIDMKCMAG IQGPVYVGSG CCFNRRALYG FDPAFATDDN  600
EDEAAAHWSW RCLRKVKQSA LRRTLSAVPL LDSEDSDEET QAGTLEQQSN SYSWRRRRVR  660
SYRAALERHF GRSPVFVASA FAKHGHRPVP AASLLSEAIH TRWGKDVGWM YVSGGSGGAV  720
ATGFKMHARG WASAYCVPAR AAPSEELAAA SRRAVAAMGV VLSQHCPIWA EGGRLSLLQR  780
LAYVSCLAYP LVSLPLTVYC ALPAVCLLTG RFIFPDTMSD YDDVLLILLL SSVIASVVLE  840
LRWSGVPLRA WWRDQKLWVV TGTSTSLAAV FQGVLRACTG IDVGFTGDTT GCSTSSSSSS  900
EDERGEECTD ARRSVRWSNL LVPPASLLLG NLAGAVVALS YGVDHGYLSW GPVVAKLTMA  960
AWVVAHLQAF LRGLLARRDR APTLAVLWSV LFVSVLSLLW VNIDSYYAPP AQATWPSQVL  1020
GESIPFPSTH STTVGLYFSP IFASNCKSML QPSRVASPAH LNASGVTIEM AGAVIQRNKR  1080
LSLKSTDSFS RSLSAGEATS TPTVCAMSAR GARRGPPTTT CSRRWVTSCA LVVRAQVRRA  1140
AQRANGMGHQ TPFTTDHGVR VKSKPAVTST HTMYVSTALP EARAPHLPIP IQRRETHSTH  1200
APRAATVPAR RRDRTARFWS GPWTQCSERS NHSLGYASHA LALHIHTDFT LSLGLPLRSP  1260
PLPKAGVGSG GTTMAANWPD ASGACTAVSD GSDKPEAPHT PPQAGGNKAA ADEVVEKVEG  1320
LEIGGGGERR LDKYEIPVEV TGDDAPPPVD SFEAAGLAEA VLRCVARCGY DSPTPVQRYA  1380
LPIARAGRDL MACAQTGSGK TAAFCLPVVS ALVTAGAGGG GGGGGGGGSR GRRDRGSFDR  1440
TARPRALILA PTRELASQVE TPPLSLSISL SLSLSPSVLC ACTGMRLLPP IRCAKWRDEV  1500
HAAARLLDPP RTRVPARSGP RALVFAGL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5jnp_A1e-583424663127Probable cellulose synthase A catalytic subunit 8 [UDP-forming]
5jnp_B1e-583424663127Probable cellulose synthase A catalytic subunit 8 [UDP-forming]
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtCatalytic subunit of cellulose synthase terminal complexes ('rosettes'), required for beta-1,4-glucan microfibril crystallization, a major mechanism of the cell wall formation. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025810469.10.0putative cellulose synthase A catalytic subunit 11 [UDP-forming]
SwissprotQ69XK50.0CESAB_ORYSJ; Putative cellulose synthase A catalytic subunit 11 [UDP-forming]
TrEMBLA0A3L6S0920.0A0A3L6S092_PANMI; Uncharacterized protein
STRINGSb10g023430.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1427255