PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02315.1.g00210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 249aa    MW: 27321.4 Da    PI: 7.3484
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02315.1.g00210.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_154.13.5e-17117169456
                                   XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                                    kr rr+ +NRe+ArrsR RK+a+++eLe  v++L++eN +L k+l+e +++ 
  Zmw_sc02315.1.g00210.1.sm.mk 117 TKRIRRMVSNRESARRSRWRKQAQLAELESQVEQLKGENATLFKQLSEANQQF 169
                                   69*****************************************9888877765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.2E-16114178IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.128116168IPR004827Basic-leucine zipper domain
PfamPF001705.7E-15117168IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.5E-13118170No hitNo description
Gene3DG3DSA:1.20.5.1702.0E-13118169No hitNo description
CDDcd147027.97E-19119169No hitNo description
PROSITE patternPS000360121136IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MKNCASELQL EAFIREEAAA GRNEQSCRPL HGGLGFGDQN AMDGSSDENP WSSGSIRTPE  60
PASSSSVEWQ RAVISAASTS GTSSTNHGNE SQSGSNSESL IDVEGVPCER SIKPLKTKRI  120
RRMVSNRESA RRSRWRKQAQ LAELESQVEQ LKGENATLFK QLSEANQQFT TAVTDNRILR  180
SDVEALRVKV KMAEDMVARS AVSCGLSDIA LAPLLNSRKM CQALEAQTQL DKFRTHEYKS  240
NASLKSLDD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1130137RRSRWRKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds to the DNA specific sequence 5'-TGAGTCA-3' found in seed storage protein gene promoters. {ECO:0000269|PubMed:11133985}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965642.19e-81bZIP transcription factor RISBZ5
SwissprotQ6H5007e-71RSBZ4_ORYSJ; bZIP transcription factor RISBZ4
TrEMBLA0A0A9PGC18e-83A0A0A9PGC1_ARUDO; Uncharacterized protein
STRINGPavir.Da00268.1.p2e-81(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20953796
Publications ? help Back to Top
  1. Onodera Y,Suzuki A,Wu CY,Washida H,Takaiwa F
    A rice functional transcriptional activator, RISBZ1, responsible for endosperm-specific expression of storage protein genes through GCN4 motif.
    J. Biol. Chem., 2001. 276(17): p. 14139-52
    [PMID:11133985]
  2. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]