PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02302.1.g00050.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 356aa    MW: 38825.7 Da    PI: 7.2327
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratk 79 
                                     lppGfrFhPtdee+v+ yL +k  + +++  ++i+ev+++k+eP+dLp+k+k +ekewyfF+++d ky+tg r+nratk  16 LPPGFRFHPTDEEVVTSYLLRKFLNPSFDP-RAIAEVNLNKCEPRDLPSKAKMGEKEWYFFCHKDMKYPTGVRTNRATK 93 
                                     79*************************999.88***************99999************************** PP

                             NAM  80 sgyWkatgkdkevlsk.......kgelvglkktLvfykgrapkgektdWvmheyrle 129
                                     +gyWkatgkd+e+++        ++elvg+kktLvfy+grap+g+kt+Wvmhe+rle  94 EGYWKATGKDREIFKPvsdggggRRELVGMKKTLVFYTGRAPRGSKTNWVMHEFRLE 150
                                     ***************999999888888***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.14E-5913176IPR003441NAC domain
PROSITE profilePS5100555.37216176IPR003441NAC domain
PfamPF023651.1E-2717149IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-481317817170NAC domain-containing protein 19
3swm_B1e-481317817170NAC domain-containing protein 19
3swm_C1e-481317817170NAC domain-containing protein 19
3swm_D1e-481317817170NAC domain-containing protein 19
3swp_A1e-481317817170NAC domain-containing protein 19
3swp_B1e-481317817170NAC domain-containing protein 19
3swp_C1e-481317817170NAC domain-containing protein 19
3swp_D1e-481317817170NAC domain-containing protein 19
4dul_A1e-481317814167NAC domain-containing protein 19
4dul_B1e-481317814167NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in stress response (By similarity). Binds to DNA-specific sequences of CLPD1 and OAT promoters in vitro (PubMed:18813954). {ECO:0000250|UniProtKB:Q7F2L3, ECO:0000269|PubMed:18813954}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salt and cold stresses. {ECO:0000269|PubMed:18813954}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004977422.11e-132NAC domain-containing protein 77
SwissprotQ5CD176e-93NAC77_ORYSJ; NAC domain-containing protein 77
TrEMBLK3Y8761e-130K3Y876_SETIT; Uncharacterized protein
STRINGSi010417m1e-131(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number