PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02296.1.g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family TCP
Protein Properties Length: 187aa    MW: 19861.5 Da    PI: 9.9826
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02296.1.g00020.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP104.91.3e-3273140572
                           TCP   5 kdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssase 72 
                                   ++++ ++hTkv gR+RRvR+++ +aar+F+L++eLG+ +d++tieWLl+qa+p+i+++tgt+ +++++
  Zmw_sc02296.1.g00020.1.sm.mk  73 RRTSADRHTKVAGRGRRVRIPVMVAARVFQLTRELGHRTDGETIEWLLRQAEPSIIAATGTGVTPEEA 140
                                   67889********************************************************7777633 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136925.32176130IPR017887Transcription factor TCP subgroup
PfamPF036343.4E-2776138IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MAFSPTTRRP HLAAPIPSFP SNSKQMSSPS EIVLYNVVPT QTLNPAPATA ADLSVSASAP  60
QPQQQIPVRG RGRRTSADRH TKVAGRGRRV RIPVMVAARV FQLTRELGHR TDGETIEWLL  120
RQAEPSIIAA TGTGVTPEEA PPAAVPVAGS AAAPYMPVPY YTSLLMQPPP VEESAASASV  180
TNAEENH
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975168.14e-66PREDICTED: transcription factor PCF1-like
SwissprotO238752e-57PCF1_ORYSJ; Transcription factor PCF1
TrEMBLA0A0Q3E6C71e-65A0A0Q3E6C7_BRADI; Uncharacterized protein
TrEMBLI1IW289e-66I1IW28_BRADI; Uncharacterized protein
STRINGBRADI5G02880.13e-65(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141722627