PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02289.1.g00060.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 207aa    MW: 22494.3 Da    PI: 6.1413
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                           NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdL 47
                                  lppG++F Ptd+e+vv+yL+ ++ +++l+  +vi++ di++++P dL 15 LPPGYKFYPTDQEIVVCYLRCRAVNQPLPS-TVIADKDILDHHPADL 60
                                  79**************************99.89*************9 PP

                           NAM 101 glkktLvfykgrapkgektdWvmheyrl 128
                                   g+k tLvfy+g++ +ge tdWvm+eyrl  63 GMKSTLVFYNGKQTSGEPTDWVMQEYRL 90 
                                   8*************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.11E-2510100IPR003441NAC domain
PROSITE profilePS5100512.55715158IPR003441NAC domain
PfamPF023656.0E-101690IPR003441NAC domain
SuperFamilySSF1019418.11E-25146156IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number