PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02285.1.g00050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 347aa    MW: 37833.2 Da    PI: 10.4165
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02285.1.g00050.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_122.82e-072542961557
                                   HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1  15 eAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                                   ++A rs +RK  +i+eLe+kv+ L++e ++L  +l  l+  +a
  Zmw_sc02285.1.g00050.1.am.mk 254 ISAARSKERKMRYIAELEQKVQILQTEATTLSAQLTLLQRDSA 296
                                   69********************************999987766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.9E-5248304IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.1E-6254296No hitNo description
CDDcd147032.47E-16254296No hitNo description
SuperFamilySSF579591.61E-6254294No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MPRHRPPRDA FPAWSCRDPG EHTKGPRKET RRKRDAEASD AVSAAEVSRG WLATPPQGPP  60
PLPHEGGTTK RRLNTHKSAR PAKHRSIRSH RRAPLPPHAA RKAAAHRRSR SDVPLGYFPP  120
PKVEAGLGGH HDADDLFTAF LNLEGLDGLH NSSDERHDDG DRDSRGSSMK MTNGADSSEN  180
ESEEGAAADR RPAGVRLWAT DAINRLEGLN LKRSAAGEPS AAPMVRHARS LSVDSLIGKF  240
NFSAGGTTSA TSGISAARSK ERKMRYIAEL EQKVQILQTE ATTLSAQLTL LQRDSAGIAT  300
QNNELKFRLQ AMEQQAQLRD GNIPRAEVVD ADMLACPSSW VHVHLTS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025796879.12e-94transcription factor RF2b-like
TrEMBLA0A2S3IUN25e-93A0A2S3IUN2_9POAL; Uncharacterized protein
STRINGPavir.J29906.1.p3e-92(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576