PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02280.1.g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MIKC_MADS
Protein Properties Length: 151aa    MW: 17270.9 Da    PI: 9.9683
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02280.1.g00020.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF84.56.5e-27959151
                                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                  krien +nrqvtfskRr+gi KKA E+ vLCda+v ++ifss gkly+y++
  Zmw_sc02280.1.g00020.1.sm.mk  9 KRIENATNRQVTFSKRRAGIVKKAREIGVLCDADVGIVIFSSAGKLYDYCT 59
                                  79***********************************************96 PP

2K-box52.91.5e-1871145169
                         K-box   1 yqkssgksleeakaeslqqelakLkkeienLq......reqRhllGedLesLslkeLqqLeqqLekslkkiRskK 69 
                                   yq++sgk l+++k++sl+ e++++kke++n+q       +  hl+GedL+sL+ +eL  +e++L+++ ++ R+k+
  Zmw_sc02280.1.g00020.1.sm.mk  71 YQTNSGKILWDEKHKSLSAEIDRVKKENDNMQielrlvLTAQHLKGEDLNSLQPRELIAIEEALQNGQTNLREKQ 145
                                   89999999************************5555554456*******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.2E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.721161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-32296IPR002100Transcription factor, MADS-box
CDDcd002651.59E-40280No hitNo description
PRINTSPR004041.6E-28323IPR002100Transcription factor, MADS-box
PfamPF003194.2E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-283859IPR002100Transcription factor, MADS-box
PfamPF014861.8E-882146IPR002487Transcription factor, K-box
PROSITE profilePS512979.37684151IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 151 aa     Download sequence    Send to blast
MGRGKIEIKR IENATNRQVT FSKRRAGIVK KAREIGVLCD ADVGIVIFSS AGKLYDYCTP  60
RTTLSRILEK YQTNSGKILW DEKHKSLSAE IDRVKKENDN MQIELRLVLT AQHLKGEDLN  120
SLQPRELIAI EEALQNGQTN LREKQAIIHW L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-19186178Myocyte-specific enhancer factor 2B
1tqe_Q1e-19186178Myocyte-specific enhancer factor 2B
1tqe_R1e-19186178Myocyte-specific enhancer factor 2B
1tqe_S1e-19186178Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00080ChIP-seqTransfer from AT5G20240Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004962034.13e-92PREDICTED: MADS-box transcription factor 4-like
SwissprotQ407035e-88MADS4_ORYSJ; MADS-box transcription factor 4
TrEMBLK3Z9J34e-92K3Z9J3_SETIT; Uncharacterized protein
STRINGSi023214m1e-91(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34343877