PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02267.1.g00180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family TCP
Protein Properties Length: 274aa    MW: 29127.6 Da    PI: 9.0999
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02267.1.g00180.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP942.9e-29501443100
                           TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssas 83 
                                   g+kdrhsk+ T +g+RdRRvRls+++a++++dLqd+LG+ ++sk ++WL+ +a+++i++l+ +++++++   a++ +   +
  Zmw_sc02267.1.g00180.1.sm.mk  50 GGKDRHSKVRTVKGLRDRRVRLSVPTAIQLYDLQDRLGLSQPSKVVDWLIDAAQHEIDKLPPLQFPPQH---AQDLVAHLQ 127
                                   78*************************************************************999993...335555555 PP

                           TCP  84 nsssgkaaksaakskks 100
                                    +s+ +  +s+a   ++
  Zmw_sc02267.1.g00180.1.sm.mk 128 PPSILAPFTSTAAADSA 144
                                   44444333333333333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.7E-2651114IPR005333Transcription factor, TCP
PROSITE profilePS5136929.40251109IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MISGNHTNEE LASCRKAEQP AGAGKSAVAS SRHWPPSTES RIVRVSRVFG GKDRHSKVRT  60
VKGLRDRRVR LSVPTAIQLY DLQDRLGLSQ PSKVVDWLID AAQHEIDKLP PLQFPPQHAQ  120
DLVAHLQPPS ILAPFTSTAA ADSAATAASS MLDGNKGRGI KGLMGLNNSV SLVNGAMPLA  180
HGLYFAGESW TNGGSVHDQV SHGNSPQPTV AHHSPFSSLL SLAPGPQLVF YSPEGGGFGM  240
KEAQDQFPVD NLEHSQGQLS LSSARSFLHS GSQG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A2e-2056110155Putative transcription factor PCF6
5zkt_B2e-2056110155Putative transcription factor PCF6
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961521.11e-143transcription factor TCP13 isoform X1
RefseqXP_004961522.11e-143transcription factor TCP13 isoform X1
RefseqXP_012700333.11e-143transcription factor TCP13 isoform X1
TrEMBLK3Z8G31e-142K3Z8G3_SETIT; Uncharacterized protein
STRINGSi022830m1e-143(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24903584