PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02229.1.g00050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 280aa    MW: 30449.9 Da    PI: 6.3398
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02229.1.g00050.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP699.1e-22143190350
                                   SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEE CS
                           SBP   3 qvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfh 50 
                                    vegC++dls+ak+yhr+h+vCe+h kap+v+v+gle+rfCqqCsr  
  Zmw_sc02229.1.g00050.1.am.mk 143 AVEGCNVDLSSAKHYHRKHRVCEAHCKAPMVVVAGLERRFCQQCSRLQ 190
                                   59*******************************************974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.1E-22136190IPR004333Transcription factor, SBP-box
PROSITE profilePS5114117.392139216IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.1E-21143191IPR004333Transcription factor, SBP-box
PfamPF031101.5E-17144190IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MVGRCRSSKD RDLLELKRCL SSSQAQLQDA PSYTIDLRQS DELASNRRRR SSEPPSLWGS  60
VQSGKVAILL ASVPSDISSF SSFLQFLHVD GCEQRFVLQF WPEFFQDELE TDGLHDVGLG  120
KFSSVSGEAG RVEDSGTSEP SMAVEGCNVD LSSAKHYHRK HRVCEAHCKA PMVVVAGLER  180
RFCQQCSRLQ IHQNKISSGE ANGNGVQAPA TTSNSNGAPV TRRALSLLSD DPWASGPAVN  240
QQFSSHVHSG AMPPLLASNP VLHELDSTSG GFWQDPPSLD