PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02172.1.g00160.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 152aa    MW: 17088.4 Da    PI: 9.5321
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02172.1.g00160.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_155.41.3e-1780136359
                                   XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 
                                   +++r +r+++NRe+A rsR+RK+a++e+Le++v  L  eN +Lkk+ +elk eva+l
  Zmw_sc02172.1.g00160.1.am.mk  80 DDRRSIRMMRNRESALRSRARKRAYVENLEKEVRRLVDENLKLKKQCKELKLEVAAL 136
                                   5799************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1707.0E-1678136No hitNo description
SMARTSM003381.9E-1478142IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.5380136IPR004827Basic-leucine zipper domain
PfamPF001701.0E-1481136IPR004827Basic-leucine zipper domain
CDDcd147071.72E-1782136No hitNo description
SuperFamilySSF579591.63E-1282136No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 152 aa     Download sequence    Send to blast
MAARANYQHY HMAATAAAWR EPDSPQLSFV SGCSSLFSIS TLQDYDDVVI AGHALPSTPV  60
SLAGFAADEV DMEVQQISGD DRRSIRMMRN RESALRSRAR KRAYVENLEK EVRRLVDENL  120
KLKKQCKELK LEVAALVLPT KSSLRRTSST QF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025812603.11e-91bZIP transcription factor 46-like
TrEMBLA0A2S3HG733e-90A0A2S3HG73_9POAL; Uncharacterized protein
TrEMBLA0A2T7DU083e-90A0A2T7DU08_9POAL; Uncharacterized protein
TrEMBLA0A3L6PES23e-90A0A3L6PES2_PANMI; Protein FD-like
STRINGSi007412m1e-90(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40173072