PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02166.1.g00160.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 861aa    MW: 92270.8 Da    PI: 10.5793
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02166.1.g00160.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1707.5e-534816091128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   lppGfrFhPtdeelvv+yLkkk+++ +l++ ++i+evd+yk++Pw+Lp+k++ +e+ew+fFs+rd+ky++g r+nra++sg
  Zmw_sc02166.1.g00160.1.am.mk 481 LPPGFRFHPTDEELVVHYLKKKAASMPLPV-TIIAEVDLYKFDPWELPAKASFGEHEWFFFSPRDRKYPNGARPNRAATSG 560
                                   79****************************.89***************9989999************************** PP

                           NAM  82 yWkatgkdkevlsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   yWkatg+dk+++++  ++e+vg+kk Lvfy+g+ pkg kt+W+mheyrl
  Zmw_sc02166.1.g00160.1.am.mk 561 YWKATGTDKPIFASggSREKVGVKKALVFYRGKPPKGIKTNWIMHEYRL 609
                                   *************9777788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.58E-62477648IPR003441NAC domain
PROSITE profilePS5100561.295481648IPR003441NAC domain
PfamPF023656.2E-27482609IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 861 aa     Download sequence    Send to blast
MAGLTDVLIL ATGLVIYRTP ATELQKFLAP TVFPRPHQPS VRTAGLFSRL VLVAAQTRDR  60
NHSRFESTVS LSSAAAAAAF LCRLDQRTHL TRAPRSGCMD AVRHPLHERA RARSKRLTNR  120
ATRHGSTATK SPGLLGTGRR RAARPPRSRW SRARELDRFL NYGGAVVNRA RGEAATQLRS  180
FGAAEPQNFP FRSGPYQHPT CMAMSPVWFC SWVACVYLGG SKTSAADRPS KCASSPTLLH  240
LGQPHAPQHC LGHPQGRSSV GFELPTRLRL TLDRIQLSAP CACYRLPMPV ATSPVSYRCW  300
ASVPSDQRSR RTLLLEPAAA PCLSAQGGPS MESPDGRRIR GSFFCRRRLK QGIRATAAGR  360
AGDKCATVRG ALGRGRWLPD TPYGGSLRTC RAARGPDRLA TCLLASVSGW LSFIGGAKGP  420
ETSTKNPSTD HSPACAALPL LLTDTATNLG LFARTRSTES TDSSSGSAPP QRKQPGPAPH  480
LPPGFRFHPT DEELVVHYLK KKAASMPLPV TIIAEVDLYK FDPWELPAKA SFGEHEWFFF  540
SPRDRKYPNG ARPNRAATSG YWKATGTDKP IFASGGSREK VGVKKALVFY RGKPPKGIKT  600
NWIMHEYRLA DAASSVNTSR PPPGSGGGGK AAASLRLDDW VLCRIYKKVN KYGVGEHLQR  660
SMDGGEDCVE DAVGAYRLSH AATGDMAIAS GGENYTKLLH HNGNNFLDGL LIVDDGSLTA  720
GASSLNHLAA VATASPAVTK QLLAPPGSTP FNWLDTSAKA ILPPAKTCHG FSRDTTDGGT  780
SSLSSPAERN HLAVPGSSAG DIGASSGGAV AVPTLLNPFR MQQGAAYLHH HASFLGTSMP  840
PETTSCAFQN PYQPAGVNWN P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A4e-6747164810168NAC domain-containing protein 19
3swm_B4e-6747164810168NAC domain-containing protein 19
3swm_C4e-6747164810168NAC domain-containing protein 19
3swm_D4e-6747164810168NAC domain-containing protein 19
3swp_A4e-6747164810168NAC domain-containing protein 19
3swp_B4e-6747164810168NAC domain-containing protein 19
3swp_C4e-6747164810168NAC domain-containing protein 19
3swp_D4e-6747164810168NAC domain-containing protein 19
3ulx_A5e-6748065214172Stress-induced transcription factor NAC1
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00058PBMTransfer from AT1G61110Download
Motif logo
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75723649