PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02157.1.g00130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 410aa    MW: 45322.6 Da    PI: 4.2509
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02157.1.g00130.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM146.41.5e-45101352128
                             NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknrat 78 
                                     ppGfrF+Ptdeelv ++Lk+++++ + +    i++vd+yk++P++Lp+  ++++++++w+fFs+ d+ky++g+r++r+t
  Zmw_sc02157.1.g00130.1.sm.mkhc  10 PPGFRFSPTDEELVLYFLKRRIASGRPTP--YIADVDVYKFHPSHLPErsALQTGDRQWFFFSRLDRKYPNGSRASRTT 86 
                                     8*********************9999555..6**************94357888999********************** PP

                             NAM  79 ksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                      +gyWkatg+d+ v+s +g+ vg kktLv+++grap+ge+tdWvm ey++
  Zmw_sc02157.1.g00130.1.sm.mkhc  87 GDGYWKATGRDRFVCS-GGRSVGNKKTLVYHHGRAPRGERTDWVMYEYTI 135
                                     ***************9.99*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.09E-527158IPR003441NAC domain
PROSITE profilePS5100550.9069158IPR003441NAC domain
PfamPF023654.5E-2310135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MENPPPRRWP PGFRFSPTDE ELVLYFLKRR IASGRPTPYI ADVDVYKFHP SHLPERSALQ  60
TGDRQWFFFS RLDRKYPNGS RASRTTGDGY WKATGRDRFV CSGGRSVGNK KTLVYHHGRA  120
PRGERTDWVM YEYTILADAL PQAAEAREAY ALYKLFQKSG VGPKNGEQYG APFREEDWLD  180
DEEEHGLPSG AAAHTVTTTT NNCTAAIEEQ ADRELTVGEL EELLSEFGND QDQGEAQLAF  240
STPISSQCQG WLNDAGNKLE SVDTTTVSGA LPVVENCQHE DHQVWLDADK EEEVDATGPI  300
VNSGAVVTAG CIGSEILDGD LERLLLQIAS DQGMVEPISD FSAPFPHHNL NQVGIGDFVS  360
PGNPVETNSA EGTSAQYSVS GSVNYNCQDA NEEFLEINDF FDLDDVEQNA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-431013516140Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). Transcriptional activator that promotes leaf senescence by up-regulating senescence-associated genes in response to developmental and stress-induced senescence signals. Functions in salt and oxidative stress-responsive signaling pathways. Binds to the promoter of NAC029/NAP and NAC059/ORS1 genes (PubMed:23926065). {ECO:0000250|UniProtKB:Q949N0, ECO:0000269|PubMed:23926065}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By cold, salt, drought stress and methyl methanesulfonate (MMS) treatment. {ECO:0000269|PubMed:17158162}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025802095.10.0NAC domain-containing protein 82-like
SwissprotA4FVP62e-70NAC16_ARATH; NAC domain-containing protein 16
TrEMBLA0A3L6T5I80.0A0A3L6T5I8_PANMI; Uncharacterized protein
STRINGPavir.J04800.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP91282840
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Sakuraba Y,Han SH,Lee SH,Hörtensteiner S,Paek NC
    Arabidopsis NAC016 promotes chlorophyll breakdown by directly upregulating STAYGREEN1 transcription.
    Plant Cell Rep., 2016. 35(1): p. 155-66
    [PMID:26441053]