PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02125.1.g00060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family TCP
Protein Properties Length: 470aa    MW: 48278 Da    PI: 7.5275
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02125.1.g00060.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP118.77e-371792836111
                           TCP   6 drhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnss 86 
                                    r+ ++hTkv+gR+RR+R++a caar+F+L++eLG+++d++ti WLlqq++pai+++tgt++ +a ++ +++ +    ++s
  Zmw_sc02125.1.g00060.1.am.mk 179 PRNRDRHTKVEGRGRRIRMPAACAARIFQLTRELGHKSDGETIRWLLQQSEPAIIAATGTGTVPAIAT-TVDGVLRIPTQS 258
                                   6999********************************************************88888444.444444444444 PP

                           TCP  87 sgkaaksaakskksqksaasalnla 111
                                   s+++++sa    + ++s+a+ + + 
  Zmw_sc02125.1.g00060.1.am.mk 259 SSSSSPSALAVVDGDESSAKRRRKL 283
                                   4433333332222222222222222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136927.381181235IPR017887Transcription factor TCP subgroup
PfamPF036342.4E-30181273IPR005333Transcription factor, TCP
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008361Biological Processregulation of cell size
GO:0048364Biological Processroot development
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MSCGALACLQ ACSLKLVHCP THPTCNTINS YRWIQLGRPG PSASGPRSTA GPAATITIKA  60
AGPGTGQPGP HPDPVGRLPR DSCDAQIREP SKPSLLPPTR NERDEPQATN PAASCSIRAM  120
EAPQAQDRAA AEEDAARQHQ VPSGGGAAMG AIPMHGFIVP KPEPVEYFSG MAMVRKPPPR  180
NRDRHTKVEG RGRRIRMPAA CAARIFQLTR ELGHKSDGET IRWLLQQSEP AIIAATGTGT  240
VPAIATTVDG VLRIPTQSSS SSSPSALAVV DGDESSAKRR RKLQPTRAGA SPLATAAPAA  300
YYPVVADPLL QGTGGAAISV PSGLAPVGAS GAPQGLVPVF AVPAAGGPVT GGANRMIPQA  360
TAVWMVPQPG GAAGAGNQPA QFWAFPAAPQ LINLAGAQTV PAGAVYQTSV SVAGYQQPQQ  420
QISTTSTHNN NKSEQQHPGS GSRGGGGADH PVEEDDDDDE EPVSDSSPEE
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681}.
UniProtTranscription activator. Binds the promoter core sequence 5'-GGNCC-3', especially at sites IIa (5'-GGGCCCAC-3') and IIb (5'-GGTCCCAC-3') (essential for meristematic tissue-specificity expression) of the PCNA gene promoter. {ECO:0000269|PubMed:12000681, ECO:0000269|PubMed:9338963}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00667PBMTransfer from GSVIVG01027588001Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008664491.31e-147transcription factor PCF2
SwissprotA2YXQ11e-145PCF2_ORYSI; Transcription factor PCF2
SwissprotQ6ZBH61e-145PCF2_ORYSJ; Transcription factor PCF2
TrEMBLA0A317Y4S81e-145A0A317Y4S8_MAIZE; Transcription factor PCF2
STRINGORUFI08G24920.11e-144(Oryza rufipogon)
STRINGOS08T0544800-011e-144(Oryza sativa)
STRINGONIVA08G25460.11e-144(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39123167
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]