PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02112.1.g00070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 383aa    MW: 41662.2 Da    PI: 9.5728
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02112.1.g00070.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.83.2e-10118155441
                                   XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeae 41 
                                    kr +r   NR +A+rsR RK+++i eLe+ v +L+  
  Zmw_sc02112.1.g00070.1.am.mk 118 PKRVKRILANRQSAQRSRVRKLQYISELERSVTTLQVD 155
                                   5999****************************999865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.3E-5115173IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.1E-10119154No hitNo description
PfamPF001702.0E-8119154IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.1E-9119160No hitNo description
CDDcd147032.12E-16120153No hitNo description
PROSITE patternPS000360122137IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MQCVASWLRL SSCSKSLVPC DPPISVAPAD GGAGEFDRLD DDQLMSMFPD EGGSASAPGS  60
ENGGSDSDGR DKRPAAAAVG AGKECADERN GNVVAKEPVP GQDAAATVAA PTELIRDPKR  120
VKRILANRQS AQRSRVRKLQ YISELERSVT TLQVDRLHML APNSNSVASE NPCACVVWSR  180
GGRRPFAWQP RDATHLASSS PELVAGSSSS RVPSPVHVRC LYPRMRCERE CESAGGTRAL  240
PPSARKTDLD DLLVSRPRRV GVFIIRGEAR HMELARYRSQ RFLRGPVSGL LARANEVSVL  300
SPRVAFLDQQ RTILTVGNSH LKQRIAALAQ DKIFKDAHQE ALKKEIERLR QVYEQQNLKM  360
SAGAPASEHG PPPPVRAEKE LMS
Functional Description ? help Back to Top
Source Description
UniProtTranscription regulator. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002456373.11e-51basic leucine zipper 6
SwissprotQ5JMK67e-45BZP06_ORYSJ; Basic leucine zipper 6
TrEMBLC5XK772e-50C5XK77_SORBI; Uncharacterized protein
STRINGSb03g034950.14e-51(Sorghum bicolor)
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]