PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02100.1.g00050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 175aa    MW: 19721.9 Da    PI: 10.002
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02100.1.g00050.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF62.93.6e-201053245
                                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
                        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                                  + en+  rq+t+skRr gilKKA+ELS+LCd+   +++fs+tgk
  Zmw_sc02100.1.g00050.1.sm.mk 10 KLENNGGRQITYSKRRSGILKKAKELSILCDIHLILLLFSPTGK 53
                                  6799999***********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.5E-26160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.759153IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.4E-21174IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-17323IPR002100Transcription factor, MADS-box
PfamPF003191.0E-171254IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-172338IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-173859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MGRVKLKIKK LENNGGRQIT YSKRRSGILK KAKELSILCD IHLILLLFSP TGKPAICIAK  60
KDQVQSVAQS KNAYTTIEEV VAKYAQLTPQ ERAKRKLESL EALKKTFKKV DHDVKIHVLG  120
LWTPDEDALF QFQNDMQLPL GLTGDPDAAS WFHNGGADVQ QPLMLPDDHT LLHQR
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms heterodimers with the MADS-box proteins AGL66 and AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010258314.19e-54PREDICTED: agamous-like MADS-box protein AGL65 isoform X1
RefseqXP_010258315.17e-54PREDICTED: agamous-like MADS-box protein AGL65 isoform X2
RefseqXP_010258316.11e-54PREDICTED: agamous-like MADS-box protein AGL65 isoform X3
SwissprotQ1PFA47e-44AGL30_ARATH; Agamous-like MADS-box protein AGL30
TrEMBLA0A0D9XUZ05e-69A0A0D9XUZ0_9ORYZ; Uncharacterized protein
TrEMBLK3ZP272e-68K3ZP27_SETIT; Uncharacterized protein
STRINGSi028357m3e-69(Setaria italica)
STRINGLPERR11G18320.19e-70(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]