PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02098.1.g00070.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 181aa    MW: 20137 Da    PI: 8.3886
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE- CS
                             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfC 43 
                                     Cqv+gC+adls a++yh+rhkvCe+h++++vv ++g+e+rfC 123 CQVDGCQADLSGARDYHKRHKVCEAHTRSTVVRIKGVEHRFC 164
                                     ****************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.3E-20115165IPR004333Transcription factor, SBP-box
PROSITE profilePS5114115.349120181IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.81E-18121165IPR004333Transcription factor, SBP-box
PfamPF031104.8E-15123165IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
Nucleic Localization Signal ? help Back to Top
No. Start End Sequence
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025819590.15e-74squamosa promoter-binding-like protein 1 isoform X1
RefseqXP_025819591.15e-74squamosa promoter-binding-like protein 1 isoform X1
RefseqXP_025819592.15e-74squamosa promoter-binding-like protein 1 isoform X2
RefseqXP_025819593.14e-74squamosa promoter-binding-like protein 1 isoform X3
RefseqXP_025819594.14e-74squamosa promoter-binding-like protein 1 isoform X4
SwissprotQ9LGU72e-59SPL1_ORYSJ; Squamosa promoter-binding-like protein 1
TrEMBLA0A2S3HW299e-73A0A2S3HW29_9POAL; Uncharacterized protein
TrEMBLA0A2S3HWL11e-72A0A2S3HWL1_9POAL; Uncharacterized protein
TrEMBLA0A2T7DNE41e-72A0A2T7DNE4_9POAL; Uncharacterized protein
TrEMBLA0A2T7DNF41e-72A0A2T7DNF4_9POAL; Uncharacterized protein
TrEMBLA0A3L6SNB55e-74A0A3L6SNB5_PANMI; Squamosa promoter-binding-like protein 1
STRINGPavir.Eb01272.1.p4e-72(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
  2. Zhang H,Zhai J,Mo J,Li D,Song F
    Overexpression of rice sphingosine-1-phoshpate lyase gene OsSPL1 in transgenic tobacco reduces salt and oxidative stress tolerance.
    J Integr Plant Biol, 2012. 54(9): p. 652-62
  3. Zhang H, et al.
    Molecular characterization of rice sphingosine-1-phosphate lyase gene OsSPL1 and functional analysis of its role in disease resistance response.
    Plant Cell Rep., 2014. 33(10): p. 1745-56