PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02085.1.g00060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LBD
Protein Properties Length: 783aa    MW: 82947.8 Da    PI: 9.5487
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02085.1.g00060.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601171.1e-364725721101
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   +CaaCk +rrkC++dC+lapyfpa++p+++a+v+++FGasn+ ++l++lp +er +a++++++eA  r++dPvyG++gvi 
  Zmw_sc02085.1.g00060.1.am.mk 472 RCAACKNQRRKCSRDCILAPYFPASDPQRYACVQRVFGASNIARVLQSLPVHERGNAADTMAMEAYRRVQDPVYGCAGVIV 552
                                   6******************************************************************************** PP

                        DUF260  82 klqqqleqlkaelallkeel 101
                                   +lq++++ +++ela++++++
  Zmw_sc02085.1.g00060.1.am.mk 553 RLQEEIRAAQSELARTQAQI 572
                                   ***************99885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.630.101.6E-465112No hitNo description
SuperFamilySSF520255.62E-43113298No hitNo description
Gene3DG3DSA:3.50.30.306.7E-37146298No hitNo description
PROSITE profilePS5089124.066471572IPR004883Lateral organ boundaries, LOB
PfamPF031959.0E-36472569IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 783 aa     Download sequence    Send to blast
MAHSSSHPGP LARLPSGSAR FLVAFGLLLL VSLLVVHRRP ALTGNSGGRH PDPAALFLSL  60
SAGANATIAV DLRALTAGPH LAGTRAAAGP ADYVLARFRA AGLQTLTREY QPLLSYPSRA  120
SLALLRPDGS LLGRLSVEEP ADVGRRLMQP YHAYAPSGEA VAEAVFVNLG RKEDYLALER  180
LGVAVRGRIA LAVRGGGYRG GVVARAAERG AVAVLIAGHA DGGVERGTVL LSGPGDPLTP  240
GWAATPQAER FDFDHEAVKQ RFPKIPSMPI SFKTAVAIIQ TLHGQAIPAE WKTNLGVDEG  300
CVKDPDVMGK MVHDTWKEMD GSINLYSPPE DYESKLSFFP GIADIISRLG NVTVEERQLA  360
LNHEVWKISR AIQRAASVLN ASFTSIWSAA AAFPPLTISA SCSRAGRMQT TDQAFAVDET  420
LTPSRSPDHT PLAQRRHSKI SPFPAWNLAV APSNHIMSMS ANAEASATPS RRCAACKNQR  480
RKCSRDCILA PYFPASDPQR YACVQRVFGA SNIARVLQSL PVHERGNAAD TMAMEAYRRV  540
QDPVYGCAGV IVRLQEEIRA AQSELARTQA QIATHQLMNA QVPAPPPPPP SPQQQAGDAL  600
TVQQEPFQGL DALLLDDARP ATGRACEVGG VQAEKIRLPT LRGSAASSVG LAASRSPHSP  660
IGTPTCGRGR LAAVRPVASP AQGRRPAAPH WFDLIPIGPG RGSQAGSHLT CQTLAVCSIY  720
AFVVLGPAVD SLSRYLSTTS RPQSSLTTGI VAGTSIWNVV VEFAGPVQTL NSFLAVLMAS  780
LIA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-2847356712113LOB family transfactor Ramosa2.1
5ly0_B5e-2847356712113LOB family transfactor Ramosa2.1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP803867