PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02027.1.g00100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 837aa    MW: 89182.5 Da    PI: 9.1974
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02027.1.g00100.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.71.6e-10243289450
                                   XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                                    kr +r   NR +A+rsR RK+++i eLe+ v +L+ e +aL  ++ 
  Zmw_sc02027.1.g00100.1.am.mk 243 PKRVKRILANRQSAQRSRVRKLQYISELERSVTSLQMEVSALSPRVA 289
                                   5999*********************************9999987665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.6E-13240304IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.634242298IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.4E-13244298No hitNo description
PfamPF001704.3E-9244293IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.34E-11244298No hitNo description
CDDcd147032.14E-24245295No hitNo description
PROSITE patternPS000360247262IPR004827Basic-leucine zipper domain
PfamPF016995.7E-5646828IPR004837Sodium/calcium exchanger membrane region
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055085Biological Processtransmembrane transport
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 837 aa     Download sequence    Send to blast
MAMPCLTLSL DAICKVTAGK FNITSKQGAA THVLLLAGWQ KETCNSTSTG EKGKVASKAK  60
QRPAHVTCMW DDRDPVRTDH LTAARAASSR CVQHLAPSVP VAVDLTPAAV AARVGNEESD  120
ERARNGASAA EGSQRGAGGA GPLVGGGRVP RVRGGAARRX XXXSASDSAA FLEAVPMDDV  180
IGGGDEFDRL DDEQLMSMFS DVDGPAVSDG AGDRAAEAQL MDVGDAEDMS PAGARAADGA  240
ADPKRVKRIL ANRQSAQRSR VRKLQYISEL ERSVTSLQME VSALSPRVAF LDHQRSLLTV  300
GNSHLKQRIA ALAQDKIFKD AHQEALKTEI ERLRQLYHQQ QIKATGGAEL ATAASTQARQ  360
ELLFGSRRPL RRHRPPCVLP RPKAPEPTQL PVQILKPSNG RPSRPGQALA HGARRINQAG  420
EPGLGDTAGT GDGENWRGIG GGREEPGSST RRRLVGTGCF GAPEFEAQAH LTCRFFRTQI  480
RRPNCTAKPY ASALQHAKPN PELRSACCPE EHVAGARRPR RLPSRNPAPT CSAVHPAPEP  540
LSHSTPLRPP RRLPQTRTRA LLPAHSLPMA VPRTLLLLVA VGGAVTLTHG RLLVRDDDGG  600
GGFLPGSATA LRLPSWAAPV AAAGGEECEM PYGFLPCTAT VGGNLFLVLA YGFLMFKSAT  660
YLSAGSELLL AILGPGIVGG LCLPILGALP DTMLILVSGL AGTKEVAQSQ VLIGMGLLAG  720
STVMLLTLLW GSCVVVGKCD LPDNSTAIDS RDTKGFSLFG MLRGMFLVVF CKTTEHQTGL  780
TWDFSSEVLV IFLVCMIMGL FTSFRTKFPL WTCLVAFLLY PSSLIVVYVL DFKFGWT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1517524RPRRLPSR
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132238125