PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02023.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 181aa    MW: 20049.5 Da    PI: 6.9762
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02023.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.31.8e-50431682128
                           NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgy 82 
                                   +pGfrFhPt+eel+ +yL++kveg+++++ + i+++d+y+++Pw+Lp+++  + kew+f+++rd+ky++g+r+nr+t+sgy
  Zmw_sc02023.1.g00010.1.am.mk  43 MPGFRFHPTEEELIEFYLRRKVEGRRFNV-DLIADLDLYRFDPWELPAMAVMGGKEWFFYVPRDRKYRNGDRPNRVTASGY 122
                                   79***************************.99***************7767789*************************** PP

                           NAM  83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   Wkatg d+ +  ++++ +glkktLvfy+g+apkg++++W+m+eyrl
  Zmw_sc02023.1.g00010.1.am.mk 123 WKATGADRMIRGEDNRPIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 168
                                   ********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-5542173IPR003441NAC domain
PROSITE profilePS5100551.64542181IPR003441NAC domain
PfamPF023652.1E-2544168IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MSRDLEDGHG GAVAAGGGAG SSEASVGGGA GDGGDSHDND LVMPGFRFHP TEEELIEFYL  60
RRKVEGRRFN VDLIADLDLY RFDPWELPAM AVMGGKEWFF YVPRDRKYRN GDRPNRVTAS  120
GYWKATGADR MIRGEDNRPI GLKKTLVFYS GKAPKGVRSS WIMNEYRLPP PAADADPLTH  180
K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-544417219146NO APICAL MERISTEM PROTEIN
1ut4_B1e-544417219146NO APICAL MERISTEM PROTEIN
1ut7_A1e-544417219146NO APICAL MERISTEM PROTEIN
1ut7_B1e-544417219146NO APICAL MERISTEM PROTEIN
4dul_A1e-544417219146NAC domain-containing protein 19
4dul_B1e-544417219146NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269|PubMed:17653269}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269|PubMed:17653269}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004962060.11e-105NAC domain-containing protein 35
SwissprotQ9ZVP83e-82NAC35_ARATH; NAC domain-containing protein 35
TrEMBLK3Z6L91e-103K3Z6L9_SETIT; Uncharacterized protein
STRINGPavir.J00477.1.p1e-107(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28263787
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Okajima K
    Molecular mechanism of phototropin light signaling.
    J. Plant Res., 2016. 129(2): p. 149-57
    [PMID:26815763]
  3. Nakasone Y,Ohshima M,Okajima K,Tokutomi S,Terazima M
    Photoreaction Dynamics of LOV1 and LOV2 of Phototropin from Chlamydomonas reinhardtii.
    J Phys Chem B, 2018. 122(6): p. 1801-1815
    [PMID:29355019]