PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02005.1.g00210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MIKC_MADS
Protein Properties Length: 229aa    MW: 25520.8 Da    PI: 6.3672
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02005.1.g00210.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF78.74.2e-25959151
                                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                    krie+   rqvtfskRr g++KKAeELSvLCda+va+++fsst kl  ++s
  Zmw_sc02005.1.g00210.1.sm.mkhc  9 KRIESAAARQVTFSKRRCGLFKKAEELSVLCDADVALMVFSSTAKLSQFAS 59
                                    79*********************************************9986 PP

2K-box52.71.8e-18871711899
                           K-box  18 qqelakLkkeienLq...reqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93 
                                     + e++k  + +e+L      + ++ Ge+Le+Ls++eL+qLe++Le +l ++ ++K++ +leqi++l +k  +l een++
  Zmw_sc02005.1.g00210.1.sm.mkhc  87 NLEYSKYANLNEQLAeasLRLSQMRGEELERLSVEELRQLEKNLEAGLHRVLQTKDQQFLEQIDDLHQKSSQLAEENMQ 165
                                     4455555555555553337788********************************************************* PP

                           K-box  94 Lrkkle 99 
                                     Lr+++ 
  Zmw_sc02005.1.g00210.1.sm.mkhc 166 LRNQVS 171
                                     **9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006626.534161IPR002100Transcription factor, MADS-box
SMARTSM004325.2E-32160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.31E-27173IPR002100Transcription factor, MADS-box
CDDcd002657.72E-36275No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-22323IPR002100Transcription factor, MADS-box
PfamPF003191.8E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-222338IPR002100Transcription factor, MADS-box
PRINTSPR004044.1E-223859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129713.27886176IPR002487Transcription factor, K-box
PfamPF014861.6E-1691170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MARERRVIKR IESAAARQVT FSKRRCGLFK KAEELSVLCD ADVALMVFSS TAKLSQFASS  60
SMNEVIDKYN AHSKNLGKAD KPSLDLNLEY SKYANLNEQL AEASLRLSQM RGEELERLSV  120
EELRQLEKNL EAGLHRVLQT KDQQFLEQID DLHQKSSQLA EENMQLRNQV SQITPAVKQA  180
VVNAKNIVAE DGQSSESVMT ALHSGSSQDN DDGCLVFHGS NKVTAPLLI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P9e-18173173Myocyte-specific enhancer factor 2B
1tqe_Q9e-18173173Myocyte-specific enhancer factor 2B
1tqe_R9e-18173173Myocyte-specific enhancer factor 2B
1tqe_S9e-18173173Myocyte-specific enhancer factor 2B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953998.11e-132PREDICTED: MADS-box transcription factor 22
SwissprotQ9XJ661e-123MAD22_ORYSJ; MADS-box transcription factor 22
TrEMBLK7UKZ41e-136K7UKZ4_MAIZE; Putative MADS-box transcription factor family protein
STRINGGRMZM2G370777_P021e-135(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12213697