PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01994.1.g00160.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family ZF-HD
Protein Properties Length: 359aa    MW: 38263.9 Da    PI: 10.2467
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01994.1.g00160.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer94.68.5e-30291347259
                   ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                                   + v+Y+eC++NhAas+GghavDGC+Efm+  g++gta+a+ CaAC CHR+FHRreve 
  Zmw_sc01994.1.g00160.1.am.mk 291 KVVHYRECQRNHAASIGGHAVDGCREFMAL-GADGTADAFVCAACSCHRSFHRREVEA 347
                                   5799*************************9.999*********************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027042.8E-1069105IPR003854Gibberellin regulated protein
ProDomPD1257741.0E-17289346IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.0E-27293345IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015666.3E-24294345IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.468295344IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MAKLLALLLL CSLFLAAAAA AVMASAAEIA PCPGVEEGND DLHRRRSIAP SPGNHKGRKD  60
GKGNLKPSQC SGECHRRCSK THHRKPCLFF CNKCCTKCLC VPPGSPLAAA GRLDANQKSK  120
RSLGKMADTP GRLVPSLRAP PVTVLRIDRL SLRAFMERSG AGKRTEKKSR TARTPTKFAV  180
LQPGTTLAGK KLLDAFNRTP HLEGAGQASQ FIIMQNHTNN WWGTFASSNG AQPGRAFSSS  240
FLPVSPHQLP FLLVLEAPQS PPPTTTTTAA TMGPKQDPPT ANGTATRKET KVVHYRECQR  300
NHAASIGGHA VDGCREFMAL GADGTADAFV CAACSCHRSF HRREVEAAEC SSTTTTTSG
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143134120