PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01970.1.g00050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SRS
Protein Properties Length: 504aa    MW: 52887.8 Da    PI: 9.5449
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01970.1.g00050.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF7022106.2e-653044423153
                        DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkq 83 
                                   +g++sCqdCGnqakkdCah+RCRtCCksrgfdC thvkstWvpa+krrerqqqla+         a++ skr+r++   ++
  Zmw_sc01970.1.g00050.1.am.mk 304 AGSISCQDCGNQAKKDCAHMRCRTCCKSRGFDCPTHVKSTWVPATKRRERQQQLATG--------AAEPSKRPRDQ---RS 373
                                   6889*************************************************9987........56788999985...44 PP

                        DUF702  84 salsstklssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                                   sa+ +t+ ss+ +++++  +++P+evsseavfrcvr++ vd++e+e+aYqt+vsi+ hvfkGiL+d G++
  Zmw_sc01970.1.g00050.1.am.mk 374 SATPTTTASSG-EQQQMVGERFPREVSSEAVFRCVRLGPVDEDEAEVAYQTTVSIADHVFKGILHDVGPD 442
                                   45555555555.566788889***********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051427.3E-60306442IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016233.4E-27308350IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.8E-21393441IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 504 aa     Download sequence    Send to blast
MFLALQSGAD DFYLPIRSNQ ASKSRGLSRT TSRRSPTRSP HASKLAERRE RTETTDSSAG  60
GVRVYHAPLC ARRRPSPAAA PKPPARLGRL DLYASKDVEH DRGYAFRGSL AAWQGPSSLS  120
SPSPSSLTPP HHIKVEATSA QLPAYLPPPL PPPPYSRTEL LVVAHGDAIC LLSSGSRIRV  180
HSPATRYTGD PASDPPLPGG AYGSGRMAGF PLGGGGGHGR GYNHPPINPS SGAESSAAAA  240
AAAAYLYTTA TAPPRGGGFQ LWPQHHHPFQ EHSFYASNII RFADDPAAGS SSSSRGGRGS  300
GLGAGSISCQ DCGNQAKKDC AHMRCRTCCK SRGFDCPTHV KSTWVPATKR RERQQQLATG  360
AAEPSKRPRD QRSSATPTTT ASSGEQQQMV GERFPREVSS EAVFRCVRLG PVDEDEAEVA  420
YQTTVSIADH VFKGILHDVG PDPSVAGGGM MIRHAAEGSS PSTVAAGEGS VSATAPGSSS  480
AVVMDPYPTP GPYGGSSFFH GHPR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025821984.11e-125protein SHI RELATED SEQUENCE 1-like
TrEMBLA0A3L6PPK21e-130A0A3L6PPK2_PANMI; Protein SHI RELATED SEQUENCE 1-like
STRINGSi015301m1e-123(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP135435124