PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01965.1.g00200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 766aa    MW: 85616.9 Da    PI: 5.4453
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01965.1.g00200.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS347.62e-1063857571373
                          GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaal 81 
                                   l++ L++cA+a+s+gdl+ a+++L+++++++s +g++++Rla++f+++L+arla+++s++yk+l +++ts   +++ l+a+
  Zmw_sc01965.1.g00200.1.am.mk 385 LRTMLIHCAQALSTGDLRGANETLKQIKQHSSLTGNATERLAHCFAQGLEARLAGTGSQVYKSLMSKRTS---VVDYLKAY 462
                                   5789************************************************************999999...******** PP

                          GRAS  82 klfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeelee 160
                                   klf  +s + k+ h+  N++I +av+g++++Hi+ +++++G+QWp Ll+ La+ ++gpp++R Tg++ p++g   + +le+
  Zmw_sc01965.1.g00200.1.am.mk 463 KLFMAASCFKKVKHVFSNRTIADAVAGKSKLHIVEYGVQHGFQWPGLLHFLANMEGGPPEVRFTGIDLPQPGfrPAYQLEK 543
                                   ***********************************************************************9999****** PP

                          GRAS 161 tgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvv 239
                                   tgerL++ A++++vpf+f++ +a ++e++++e+L+++p+E+l+Vn+   l +l+de+v ++s  +rd vLk +++++Pkv+
  Zmw_sc01965.1.g00200.1.am.mk 544 TGERLSNCARQFHVPFKFHA-IAAKWETVTPEDLNIDPDEVLVVNCECYLDKLMDETVVVDSpsPRDMVLKNIRNMRPKVF 623
                                   ********************.799*********************************98888779**************** PP

                          GRAS 240 vvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerle 320
                                   +++  +   +++ Fl+rf eal +ysa fd+l+a++pr+++ r  +Er +lgr++ nv+acega+r+er et+++W+ r +
  Zmw_sc01965.1.g00200.1.am.mk 624 IHCVVNGTFGAPFFLTRFREALFFYSAQFDMLDATIPRDNDVRLLIERDILGRSALNVIACEGADRVERPETYKQWQVRNN 704
                                   ********************************************************************************* PP

                          GRAS 321 eaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                                   +aG++++pl+ +++k ++  + +++ + + ++e++ +l++gWk+r L+++S W
  Zmw_sc01965.1.g00200.1.am.mk 705 RAGLRQLPLRPEIVKLVRDKVTNHYHKDFLLDEDHRWLLQGWKGRVLYAISTW 757
                                   *************************888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098560.607359738IPR005202Transcription factor GRAS
PfamPF035146.9E-104385757IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 766 aa     Download sequence    Send to blast
MGKVELFGSV NLGGSSLCTW SGRRYHSPDS DRRSDFASWE EESLLHLVYS STVPSADPVA  60
AAVASPFRRL PGSFPLSSPS SRLQSTPEAL IFNSIHVSAH PTSATPLLLA MAATPEDILG  120
QGGYLAVPEP FSPSVFLDLP PTPRPDGGDD PASSDDLVLP FISRMLMEED IDENFFYQYP  180
DHPALLTSQQ PYAEILSAPS SSSDSATTNT TLTPSSFSDA AEPTWPYDPI ELVQLLRSPP  240
CPDEGLGLHD FTADDDSAVL FDGATPGFEQ ISMVDAKPLT VCNVKKEEVV VDGLSIFRER  300
SNGRGRKNRH HEDDLEMEIG RSSKLMMQEQ EDSDAQEMYR EIMSFNVEEF MKRMQDLRIA  360
KDSESEKSSR KGVRGRQGAD EVVDLRTMLI HCAQALSTGD LRGANETLKQ IKQHSSLTGN  420
ATERLAHCFA QGLEARLAGT GSQVYKSLMS KRTSVVDYLK AYKLFMAASC FKKVKHVFSN  480
RTIADAVAGK SKLHIVEYGV QHGFQWPGLL HFLANMEGGP PEVRFTGIDL PQPGFRPAYQ  540
LEKTGERLSN CARQFHVPFK FHAIAAKWET VTPEDLNIDP DEVLVVNCEC YLDKLMDETV  600
VVDSPSPRDM VLKNIRNMRP KVFIHCVVNG TFGAPFFLTR FREALFFYSA QFDMLDATIP  660
RDNDVRLLIE RDILGRSALN VIACEGADRV ERPETYKQWQ VRNNRAGLRQ LPLRPEIVKL  720
VRDKVTNHYH KDFLLDEDHR WLLQGWKGRV LYAISTWVAE GSNSIF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-373897578374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015617900.10.0PREDICTED: scarecrow-like protein 9
TrEMBLA0A0A8Z2270.0A0A0A8Z227_ARUDO; Uncharacterized protein
STRINGBGIOSGA035741-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297