PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01961.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 740aa    MW: 79738.4 Da    PI: 9.2409
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01961.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.61.2e-4082158278
                                   -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                           SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                                   C v+gC+adls+++eyhrrhkvCe+hsk+pvv+v+g+e rfCqqCsrfh+l efDe+krsCr+rL++hn+rrrk+q+
  Zmw_sc01961.1.g00030.1.am.mk  82 CAVDGCDADLSKCREYHRRHKVCEAHSKTPVVVVAGREMRFCQQCSRFHSLVEFDEAKRSCRKRLDGHNRRRRKPQP 158
                                   **************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.109.5E-3574143IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.12979156IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.57E-3780161IPR004333Transcription factor, SBP-box
PfamPF031108.8E-3182155IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 740 aa     Download sequence    Send to blast
MWPGAMLWCL FSEHKGSMPL LKGEHGPGAP LGPSPLESLQ PSTSRKLCIC CASSISLASS  60
LSLRARPRTG PGGANGPQCP SCAVDGCDAD LSKCREYHRR HKVCEAHSKT PVVVVAGREM  120
RFCQQCSRFH SLVEFDEAKR SCRKRLDGHN RRRRKPQPDD MNARSFMTSQ QGPRSSSFVT  180
PRPEPSWSGI LKSEDSSYYA HQVLCNRPHF AGSTSTYSKE GRRFPFLQDG DQLSFGTGGA  240
ASLEAATACQ SLLKTVAAPE SSSSSKIFSP DGLTPVLDSD CALSLLSSPA NSSSVDVSRM  300
VQPTEHIPMA QPLVPSMQQF GSSPSWFSQA ASSGVVVSTA GFTCPSMDSE QLNPVLVPSS  360
DGHEMNYHGI FHVGGEGSDD GTSSSLPFSS TTSVEVHTKP DAAVSNLEQM IQFRPEAAVK  420
HGTIPLCSPD AALLSSLLDP QRVCLCSLAT HGRQGLGRWL VPPQCTAVGT RQGRLARKPL  480
RPDCIPRGAG GRQGTKFCLA RPGAGRGRAD KASEHGKMSV LGVQASKVEW HVTSRGAEQP  540
PRATGRPPDL GIVDRHVVKL MMGSCRVRAP YDVAPHPAIP PPTARVRARY PADAAGGPSN  600
RWFRTADDGV RVHNLGLAPL AEGWREVSVL YSLVPLVRTE KPSRLTLTGE LRPVCSNCGN  660
QSLASSRAEP ERQPRRPVAG LEEAGNDAAH GKRKGGVAQK YDSTRFHPEK YTLYALFFIS  720
LPRPVESSLV RRRDLQTLVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-2770155184squamosa promoter binding protein-like 4
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1138155KRSCRKRLDGHNRRRRKP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00555DAPTransfer from AT5G50570Download
Motif logo
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP17553795