PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01917.1.g00150.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 494aa    MW: 53629.2 Da    PI: 10.6776
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01917.1.g00150.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_121.16.9e-074044461557
                                   HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1  15 eAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                                   ++A rs +RK  +i++Le+kv+ L++e ++L  +l  l+  +a
  Zmw_sc01917.1.g00150.1.am.mk 404 ISAARSKERKMRYIAKLEQKVQILQTEATTLSAQLTLLQRDSA 446
                                   69********************************999987766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.4E-4398454IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.01E-6404444No hitNo description
CDDcd147032.03E-15404446No hitNo description
Gene3DG3DSA:1.20.5.1702.5E-6404446No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 494 aa     Download sequence    Send to blast
MVATMGEETK NPGSFKQRHP LRPEQDGHAN ASTRMVALYA VWYAARTAYP GQHEQFERPI  60
HLTVHPHSSE TERGDAATAV HAISRPVTRG CLVTVRHVMH FPPVAGLTNA QLPTAGVLQS  120
QYLQDLAKAK LALHSTVPAA SPGTAQTAAR HAASATLLAE RLLLVTSRPP GEHTKGPRKG  180
NETKTGCRGE RSSQCRRGEQ RLATPPQGPP PLPHEGGTTK RRLNTHKSAR PAKHRSIRSH  240
RRAPLPPHAA RKAAAHRRSR SDVPLGYFPP PKVEAGLGGH HDADDLFTAF LNLEGLDGLH  300
NPSDERHDDG DRDSRGSSMK MTNGADSSEN ESEEGAADDR RPAGVRLWTA DAINRLEGLN  360
VKRSAAGEPS TAPTVRHARS LSVDSLIGKF NFSAGGTTSA TSGISAARSK ERKMRYIAKL  420
EQKVQILQTE ATTLSAQLTL LQRDSAGIAT QNNELKFRLQ AMERQAQLRD GASQNLSHLH  480
TISFLPCVHQ RPMC
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576