PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01917.1.g00130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 560aa    MW: 61097 Da    PI: 7.2899
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01917.1.g00130.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.81.2e-541432721129
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknrat 78 
                                   +ppGfrFhPtdeelv +yL+kkv+++k++l +vi+++d+y++ePwdL++     + e++ewyfFs +d+ky+tg+r+nrat
  Zmw_sc01917.1.g00130.1.am.mk 143 VPPGFRFHPTDEELVGYYLRKKVASQKIDL-DVIRDIDLYRIEPWDLQEhcgIGYDEQNEWYFFSYKDRKYPTGTRTNRAT 222
                                   69****************************.9***************953432234677********************** PP

                           NAM  79 ksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                                    +g+Wkatg+dk+v++ k++l+g++ktLvfykgrap+g+ktdW+mheyrle
  Zmw_sc01917.1.g00130.1.am.mk 223 MAGFWKATGRDKAVHD-KSRLIGMRKTLVFYKGRAPNGQKTDWIMHEYRLE 272
                                   ****************.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.22E-58140311IPR003441NAC domain
PROSITE profilePS5100557.856143311IPR003441NAC domain
PfamPF023653.5E-28144271IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:1990110Biological Processcallus formation
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 560 aa     Download sequence    Send to blast
MEFLDQATER SEAVQATETH LLLVLPGFSL AILPRPVHAR HAFVAPLDGG DGGPEVAFPL  60
LPAAPPALSK VLNYHARRPA CMQLSKVVQA RALPPPAARQ KLANAISFCY LHYLQGSGVA  120
ESDAHTYSGA APGDHMDSME SCVPPGFRFH PTDEELVGYY LRKKVASQKI DLDVIRDIDL  180
YRIEPWDLQE HCGIGYDEQN EWYFFSYKDR KYPTGTRTNR ATMAGFWKAT GRDKAVHDKS  240
RLIGMRKTLV FYKGRAPNGQ KTDWIMHEYR LETDENAPPQ ARPLAPLSFT PNKLVVVLQE  300
EGWVVCRAFK KRTAYPARSM ALAWDSSFAY RDPNVMVGAT AAEAAAFVDP NKAYAQIRRQ  360
SSKNARFKQE AELDGAAAFL QYSSHLVELP QLESPSAPLA PNTSHASTEE GGSGGGRRSK  420
KARADKVATD WRALDKFVAS QLSPGEGGDI EATASAAAAG EGSQLDHGCE EDMAALLFLN  480
SDGREEVERW TGLLGPASGR WPPLPTRVGL GMHGHGLRPT YVHGPCSHTP VATCDPSLLT  540
NFVVGPSPAG GAADLRRGRD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-4714031512172Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00266DAPTransfer from AT2G18060Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by chitin (e.g. chitooctaose) (PubMed:17722694). Accumulates in plants exposed to callus induction medium (CIM) (PubMed:17581762). {ECO:0000269|PubMed:17581762, ECO:0000269|PubMed:17722694}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022678630.10.0NAC domain-containing protein 37 isoform X1
SwissprotQ9SL411e-116NAC37_ARATH; NAC domain-containing protein 37
TrEMBLA0A368SWG20.0A0A368SWG2_SETIT; Uncharacterized protein
STRINGPavir.Ib00161.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36253768
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Negi S,Tak H,Ganapathi TR
    Cloning and functional characterization of MusaVND1 using transgenic banana plants.
    Transgenic Res., 2015. 24(3): p. 571-85
    [PMID:25523085]
  3. Tan TT, et al.
    Transcription Factors VND1-VND3 Contribute to Cotyledon Xylem Vessel Formation.
    Plant Physiol., 2018. 176(1): p. 773-789
    [PMID:29133368]