PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01894.1.g00150.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 354aa    MW: 39131.3 Da    PI: 9.611
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                           NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgy 82 
                                   +pGfrFhPt+eel+++yL+++vegk++++ e i+ vd+y+++PwdLp+ ++ ++kew+f+++rd+ky++g+r+nr+t sgy  21 MPGFRFHPTEEELIDFYLRRRVEGKRFNI-ELINLVDLYRYDPWDLPALASIGDKEWFFYVPRDRKYRNGDRPNRVTPSGY 100
                                   79***************************.89***************888889**************************** PP

                           NAM  83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   Wkatg d+ v +++++ +glkktLvfy g+apkg +++W+m+eyrl 101 WKATGADRMVRVEGNRSIGLKKTLVFYVGKAPKGLRSSWIMNEYRL 146
                                   ********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.24E-5620166IPR003441NAC domain
PROSITE profilePS5100555.24620166IPR003441NAC domain
PfamPF023655.9E-2422146IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A7e-532216622168NAC domain-containing protein 19
3swm_B7e-532216622168NAC domain-containing protein 19
3swm_C7e-532216622168NAC domain-containing protein 19
3swm_D7e-532216622168NAC domain-containing protein 19
3swp_A7e-532216622168NAC domain-containing protein 19
3swp_B7e-532216622168NAC domain-containing protein 19
3swp_C7e-532216622168NAC domain-containing protein 19
3swp_D7e-532216622168NAC domain-containing protein 19
4dul_A5e-532216619165NAC domain-containing protein 19
4dul_B5e-532216619165NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973013.10.0NAC domain-containing protein 35
TrEMBLA0A1E5V4Y20.0A0A1E5V4Y2_9POAL; NAC domain-containing protein 35
STRINGPavir.Fa02204.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number