PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01859.1.g00140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 562aa    MW: 61089.8 Da    PI: 10.3339
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01859.1.g00140.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM147.66.6e-463354521119
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   lppGfrFhPtdeelv++yL +k+ + ++   ++++e+d++k+ePw+Lp+k+k +e+ewyfFs rd+ky+tg r+nrat +g
  Zmw_sc01859.1.g00140.1.am.mk 335 LPPGFRFHPTDEELVSFYLLRKTLDGSFCG-RAVAEIDLNKCEPWELPEKAKMGEREWYFFSLRDRKYPTGLRTNRATVAG 414
                                   79*************************888.88***************99999**************************** PP

                           NAM  82 yWkatgkdkevlskkgelvglkktLvfykgrapkgekt 119
                                   yWkatgkd+ev + +g+lvg+kktLvfy+grapkg+kt
  Zmw_sc01859.1.g00140.1.am.mk 415 YWKATGKDREVRAGGGALVGMKKTLVFYRGRAPKGQKT 452
                                   *************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-48333452IPR003441NAC domain
PROSITE profilePS5100546.999335510IPR003441NAC domain
PfamPF023651.7E-20336447IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 562 aa     Download sequence    Send to blast
MHLMSTPVSL SLPAAQSCHS DPTSPCRLPC LHVHLPLSLS PAALPRGDDV TEFGGFLDRP  60
GRPADHRSSP PHLWSGSTSR SAYLLLSCKL RLPSVPCLSL ITAPAVLLSL YTRRDEGRET  120
PRKDKSNLHS FSRTLSSSLS AADGQLCSLF LFHHVCHTSV QGCQLTSIIE LISSRPSHLL  180
KIISTGGARA RQSRLERRRL PCPRRCTSPI SSHLAWPPVP ETPRHKQSSG HATHRPSAVP  240
GPSRARRRLP GTDSSNPPFT PPHPPSHLLL CSLPPAPAIK PATHQEAGSM PKNKLPLSPS  300
PANEVKILLA GRPAGNRERG AMFGGALGLD VGSDLPPGFR FHPTDEELVS FYLLRKTLDG  360
SFCGRAVAEI DLNKCEPWEL PEKAKMGERE WYFFSLRDRK YPTGLRTNRA TVAGYWKATG  420
KDREVRAGGG ALVGMKKTLV FYRGRAPKGQ KTLEGSFAYN HFPGSTRGLE QQHHSAQVRQ  480
SSGCCSCSGR SLRGYGNGAD EWVIARVFQK PGEVAPARQH HHWGPGLAGS MEVKLEASMG  540
RPVPPQMAVG PGQLDGAYAW GF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A5e-4033545220136NAC domain-containing protein 19
3swm_B5e-4033545220136NAC domain-containing protein 19
3swm_C5e-4033545220136NAC domain-containing protein 19
3swm_D5e-4033545220136NAC domain-containing protein 19
3swp_A5e-4033545220136NAC domain-containing protein 19
3swp_B5e-4033545220136NAC domain-containing protein 19
3swp_C5e-4033545220136NAC domain-containing protein 19
3swp_D5e-4033545220136NAC domain-containing protein 19
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP99403543