PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01855.1.g00140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 67aa    MW: 7999.21 Da    PI: 11.5435
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01855.1.g00140.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.25e-152163547
                                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47
                                  +r++r++kNRe+A rsR+RK a++ eLe+kv  Le+eN++L+ 
  Zmw_sc01855.1.g00140.1.sm.mk 21 RRQKRMIKNRESAARSRARKMAYTSELETKVSRLEEENERLRR 63
                                  79***************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.0E-51567IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.1E-151564No hitNo description
PRINTSPR000415.8E-51632IPR001630cAMP response element binding (CREB) protein
PROSITE profilePS5021711.5421967IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.5E-112165No hitNo description
PfamPF001701.2E-122164IPR004827Basic-leucine zipper domain
PROSITE patternPS0003602439IPR004827Basic-leucine zipper domain
PRINTSPR000415.8E-53454IPR001630cAMP response element binding (CREB) protein
PRINTSPR000415.8E-55467IPR001630cAMP response element binding (CREB) protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 67 aa     Download sequence    Send to blast
MTAPGRKRGT TGYVEDKLME RRQKRMIKNR ESAARSRARK MAYTSELETK VSRLEEENER  60
LRRQKKA
Functional Description ? help Back to Top
Source Description
UniProtBinds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961684.18e-27ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X1
RefseqXP_025818578.13e-27ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X1
RefseqXP_025818579.13e-27ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X2
SwissprotQ9LES31e-24AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLA0A2S3HQM97e-26A0A2S3HQM9_9POAL; Uncharacterized protein
TrEMBLA0A2T7DFC87e-26A0A2T7DFC8_9POAL; Uncharacterized protein
STRINGTraes_3AL_58F294736.27e-27(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27073883
Publications ? help Back to Top
  1. Kim H, et al.
    ABA-HYPERSENSITIVE BTB/POZ PROTEIN 1 functions as a negative regulator in ABA-mediated inhibition of germination in Arabidopsis.
    Plant Mol. Biol., 2016. 90(3): p. 303-15
    [PMID:26667153]
  2. Song C,Kim T,Chung WS,Lim CO
    The Arabidopsis Phytocystatin AtCYS5 Enhances Seed Germination and Seedling Growth under Heat Stress Conditions.
    Mol. Cells, 2017. 40(8): p. 577-586
    [PMID:28756655]