PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01847.1.g00150.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LBD
Protein Properties Length: 566aa    MW: 60633.9 Da    PI: 6.6324
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01847.1.g00150.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.52.9e-401062051100
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   +CaaCk+lrr+Ca++C++apyf  ++p+kfa+vh++FGasnv+k+l ++p+ er da+sslvyeA+ r+rdPvyG++g i+
  Zmw_sc01847.1.g00150.1.am.mk 106 PCAACKLLRRRCAQECPFAPYFSPHEPHKFAAVHRVFGASNVSKMLLEVPKPERADAASSLVYEANLRLRDPVYGCMGAIS 186
                                   7******************************************************************************** PP

                        DUF260  82 klqqqleqlkaelallkee 100
                                    lqqq++ l+ael+++++e
  Zmw_sc01847.1.g00150.1.am.mk 187 VLQQQVNALEAELDAVRAE 205
                                   **************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.038105206IPR004883Lateral organ boundaries, LOB
PfamPF031953.3E-40106203IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 566 aa     Download sequence    Send to blast
MQDSAVRAAN VRAFEGAETG LPSTPPPCHS SSCPSPSPKH MRACLNVHGE VCDDHRPFWE  60
RLDEIGKKIK RETDATGIAA SASTAPDENP VPRRLGLGDA LNTVTPCAAC KLLRRRCAQE  120
CPFAPYFSPH EPHKFAAVHR VFGASNVSKM LLEVPKPERA DAASSLVYEA NLRLRDPVYG  180
CMGAISVLQQ QVNALEAELD AVRAEIFKHR YRQAGAGGGA GFTGDAAQAT ASFVVPAPAV  240
HAGDVVSVAE ACQEVATPAG AQGMSPSSAV YVAEAVEQPS NTTDHYSCLN TRQGGGGGAF  300
GGVACGVCMQ LSSSYWLSSK QAKSGLVAPE SSGHETAPFP RLLVHLFIID IREEWDGEAA  360
RLGWVLLRVR GVAIGMPRDL VRNAWCSLQT TGIYRWLGCG RAPWPLTAAV LLYICTNEQL  420
AMAAARSCPM DSGLTGMDHR CPEFPASRMR CASMLSTFLT FTCFDWPTKG ADFANLEMMH  480
VVVAAARDLA RCQCSACPAR VPVNTVQQAI EAEPVYCLCT EQKAIEGQKA DTGPIRYLPD  540
ESRSEETELA EGLRHAHVTT HSPAPC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-3910620911114LOB family transfactor Ramosa2.1
5ly0_B2e-3910620911114LOB family transfactor Ramosa2.1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26303891