PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01846.1.g00070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 154aa    MW: 17004 Da    PI: 7.6174
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01846.1.g00070.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.81.3e-142483463
                                  XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1  4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                                   +re+r+ +NRe+ArrsR+RK++ ++eL ++++ L+aeN + + ++     +++++++e+
  Zmw_sc01846.1.g00070.1.am.mk 24 HRREKRRLSNRESARRSRLRKQQHLDELVQEAARLQAENARVAARAADFAAQYQRVEQEN 83
                                  58****************************************************999998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.3E-102080No hitNo description
SMARTSM003384.5E-172185IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.9092386IPR004827Basic-leucine zipper domain
PfamPF001702.6E-112483IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.26E-92572No hitNo description
CDDcd147026.00E-132659No hitNo description
PROSITE patternPS0003602843IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006971Biological Processhypotonic response
GO:0009267Biological Processcellular response to starvation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000693Biological Processpositive regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 154 aa     Download sequence    Send to blast
MSSSSLSPGG RVSGSDGDSA ADTHRREKRR LSNRESARRS RLRKQQHLDE LVQEAARLQA  60
ENARVAARAA DFAAQYQRVE QENTVLRARA AELGDRLRSV NEVLRVVEEF SGVAMDIQDE  120
LPVDDPLLRP WQLPCPAAAM PIGGATTAAH MLQY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13743RRSRLRK
23744RRSRLRKQ
Functional Description ? help Back to Top
Source Description
UniProtMay contribute to developmentally specific patterns of gene expression. Binds specifically to ocs elements which are transcriptional enhancer found in the promoters of several plant genes. OCSBF-1 is able to bind to a site within each half of the ocs element as well as to animal AP-1 and CREB sites.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00419DAPTransfer from AT3G62420Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025808697.11e-93ocs element-binding factor 1
SwissprotP240682e-89OCS1_MAIZE; Ocs element-binding factor 1
TrEMBLA0A2T7EHZ03e-93A0A2T7EHZ0_9POAL; Uncharacterized protein
TrEMBLA0A3L6R9763e-93A0A3L6R976_PANMI; Ocs element-binding factor 1
STRINGPavir.Cb00560.1.p5e-94(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188635100
Publications ? help Back to Top
  1. Singh K, et al.
    OCSBF-1, a maize ocs enhancer binding factor: isolation and expression during development.
    Plant Cell, 1990. 2(9): p. 891-903
    [PMID:2152133]