PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc01841.1.g00260.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 586aa    MW: 63894.9 Da    PI: 7.5883
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc01841.1.g00260.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.86.3e-51872151128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknrat 78 
                                   +ppGfrFhPt+eel+++yLkkkv++++++l +vi++vd++k+ePwd+++  ++ +  +++wy Fs++dkky+tg+r+nrat
  Zmw_sc01841.1.g00260.1.am.mk  87 VPPGFRFHPTEEELLTYYLKKKVASERIDL-DVIRDVDLNKLEPWDIQEkcRIGSgPQNDWYLFSHKDKKYPTGTRTNRAT 166
                                   69****************************.9***************952444443456********************** PP

                           NAM  79 ksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   ++g+Wkatg+dk+++s  ++ +g++ktLvfykgrap+g+k+dW+mheyrl
  Zmw_sc01841.1.g00260.1.am.mk 167 AAGFWKATGRDKAIYS-CTRRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 215
                                   ****************.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.93E-5385220IPR003441NAC domain
PROSITE profilePS5100550.16887255IPR003441NAC domain
PfamPF023651.8E-2688215IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 586 aa     Download sequence    Send to blast
MPPQHHSTDD FSPRPGVAPM RFRLAVLFPE IFMVVCHGSG CYMALFCIPR LLPLVVNLPL  60
PPSLSSHFFL PSLARLAGTN PRLKSVVPPG FRFHPTEEEL LTYYLKKKVA SERIDLDVIR  120
DVDLNKLEPW DIQEKCRIGS GPQNDWYLFS HKDKKYPTGT RTNRATAAGF WKATGRDKAI  180
YSCTRRIGMR KTLVFYKGRA PHGQKSDWIM HEYRLDDADH PTAAAAGDPH YPSPPLASSR  240
TPPSQQHATV HVMVDDDEVE ISLSWVWGLS ASSITRSADE RRRGGWVGVN RATESAHQQD  300
HQTCMPQAAD EPTKHRPAPA AGSHSAHRQA LVVDFCERRR LHQQGDKNGT PPIRGGAAAG  360
EQEAQEEGWA ICRMFKKKNL VLHHGQSSGS GATVAATVVS KMASVPSAME SSPTSNGSSS  420
VTVSDHVKAA QMLHSGSNVD ALDHILQYMG RSFGDNNKQD TKPPPALQMD HHHLAAACPS  480
SSFYGKFMKL PPLEHDGSVL LPNPAATDAS GIADWDSLDR LAAYELNGIS DASKNMVSFF  540
DEPSAAATTG AFTSAYTSAG AGDGDLWSLA RSSVSSLHAD LTMNNV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-438721515140Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025810838.17e-94NAC domain-containing protein 43-like
TrEMBLA0A1D6NW321e-126A0A1D6NW32_MAIZE; NAC domain-containing protein 43
STRINGSi006565m9e-93(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3624234